Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9ZLN1

Protein Details
Accession A0A4P9ZLN1    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-42GAESCDNPSQKKKERRKSKCPICNREFLRHydrophilic
NLS Segment(s)
PositionSequence
24-30KKKERRK
Subcellular Location(s) nucl 21.5, cyto_nucl 11.833, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
Amino Acid Sequences MDDQDIRHENASNGAESCDNPSQKKKERRKSKCPICNREFLRPNLLIEHQRDCEVFKLQYKCRGCNGAFGTVQGQHIHEATCSKANRCPLCPGLCENPGHRRYYPRHRPTRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.18
4 0.23
5 0.24
6 0.25
7 0.27
8 0.35
9 0.42
10 0.52
11 0.62
12 0.67
13 0.72
14 0.8
15 0.86
16 0.89
17 0.91
18 0.92
19 0.92
20 0.91
21 0.91
22 0.84
23 0.84
24 0.77
25 0.76
26 0.71
27 0.63
28 0.58
29 0.49
30 0.44
31 0.37
32 0.36
33 0.3
34 0.26
35 0.28
36 0.22
37 0.22
38 0.21
39 0.19
40 0.18
41 0.17
42 0.16
43 0.18
44 0.23
45 0.24
46 0.32
47 0.34
48 0.34
49 0.34
50 0.39
51 0.33
52 0.35
53 0.36
54 0.32
55 0.3
56 0.28
57 0.27
58 0.23
59 0.24
60 0.17
61 0.15
62 0.11
63 0.12
64 0.11
65 0.1
66 0.1
67 0.11
68 0.17
69 0.18
70 0.19
71 0.23
72 0.31
73 0.34
74 0.36
75 0.41
76 0.4
77 0.42
78 0.42
79 0.44
80 0.42
81 0.42
82 0.42
83 0.41
84 0.44
85 0.45
86 0.47
87 0.45
88 0.47
89 0.52
90 0.6
91 0.67
92 0.68