Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9ZMY8

Protein Details
Accession A0A4P9ZMY8    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-34LERNRIAALKCRQRKKQWLNNLQNTLDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
CDD cd14687  bZIP_ATF2  
Amino Acid Sequences DEKRRSFLERNRIAALKCRQRKKQWLNNLQNTLDLYSVENDKAEKQMQLLREEVLHLKTLLVAHKECP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.55
4 0.56
5 0.61
6 0.65
7 0.71
8 0.81
9 0.83
10 0.83
11 0.83
12 0.86
13 0.87
14 0.87
15 0.82
16 0.71
17 0.62
18 0.52
19 0.42
20 0.31
21 0.2
22 0.13
23 0.09
24 0.09
25 0.08
26 0.08
27 0.08
28 0.08
29 0.11
30 0.11
31 0.11
32 0.12
33 0.15
34 0.18
35 0.2
36 0.2
37 0.18
38 0.17
39 0.19
40 0.2
41 0.18
42 0.16
43 0.14
44 0.13
45 0.14
46 0.16
47 0.19
48 0.21