Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q0A2R1

Protein Details
Accession A0A4Q0A2R1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
63-88KACDGKDKNSSQKKPRPNPDNPPVVSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013520  Exonuclease_RNaseT/DNA_pol3  
IPR040151  Gfd2/YDR514C-like  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MGCQPNPNKAAVTPGPGNSKRVASKVNRPSTKRILKTQGPDSPASKADRKTDSTGKAPGRSAKACDGKDKNSSQKKPRPNPDNPPVVSEQQLAGYRSLLKNTLKMVDDGKHTILCLDIEAYEHDQNKLTEVGWCMYDPVTRQITTRHIIIKETIKLYNGRFVADNKHRFNFGKSQVMPRYEGLMELHAAVTKAYPIAFLGHDVASDIKFLKSEDMHLHHSVPRLDTKALYCAHTKNPRNGRRLAILLEELGIEYSHLHNAGNDAHYTMLVFLKIMEQNRLDSPDQPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.42
3 0.43
4 0.45
5 0.4
6 0.43
7 0.4
8 0.4
9 0.44
10 0.41
11 0.5
12 0.58
13 0.65
14 0.68
15 0.7
16 0.74
17 0.76
18 0.8
19 0.75
20 0.74
21 0.72
22 0.71
23 0.74
24 0.74
25 0.7
26 0.63
27 0.61
28 0.54
29 0.48
30 0.45
31 0.43
32 0.4
33 0.38
34 0.4
35 0.42
36 0.45
37 0.48
38 0.51
39 0.51
40 0.49
41 0.53
42 0.51
43 0.5
44 0.48
45 0.48
46 0.47
47 0.45
48 0.44
49 0.44
50 0.48
51 0.45
52 0.51
53 0.5
54 0.48
55 0.54
56 0.56
57 0.58
58 0.6
59 0.67
60 0.68
61 0.72
62 0.78
63 0.81
64 0.85
65 0.84
66 0.83
67 0.84
68 0.82
69 0.83
70 0.72
71 0.67
72 0.6
73 0.52
74 0.45
75 0.36
76 0.27
77 0.21
78 0.23
79 0.2
80 0.17
81 0.16
82 0.17
83 0.17
84 0.18
85 0.18
86 0.17
87 0.18
88 0.19
89 0.22
90 0.19
91 0.2
92 0.21
93 0.2
94 0.22
95 0.21
96 0.21
97 0.17
98 0.16
99 0.15
100 0.13
101 0.1
102 0.08
103 0.06
104 0.05
105 0.05
106 0.07
107 0.1
108 0.12
109 0.12
110 0.13
111 0.14
112 0.14
113 0.15
114 0.14
115 0.11
116 0.11
117 0.12
118 0.12
119 0.1
120 0.1
121 0.1
122 0.09
123 0.1
124 0.09
125 0.12
126 0.13
127 0.13
128 0.14
129 0.16
130 0.19
131 0.2
132 0.21
133 0.21
134 0.19
135 0.2
136 0.22
137 0.23
138 0.22
139 0.22
140 0.21
141 0.19
142 0.21
143 0.21
144 0.24
145 0.2
146 0.18
147 0.17
148 0.18
149 0.25
150 0.31
151 0.38
152 0.36
153 0.36
154 0.38
155 0.38
156 0.41
157 0.4
158 0.36
159 0.37
160 0.35
161 0.42
162 0.44
163 0.45
164 0.43
165 0.36
166 0.34
167 0.25
168 0.25
169 0.17
170 0.14
171 0.12
172 0.11
173 0.1
174 0.07
175 0.08
176 0.07
177 0.06
178 0.05
179 0.05
180 0.05
181 0.05
182 0.05
183 0.07
184 0.07
185 0.08
186 0.09
187 0.09
188 0.09
189 0.09
190 0.1
191 0.08
192 0.09
193 0.09
194 0.07
195 0.08
196 0.08
197 0.11
198 0.11
199 0.14
200 0.19
201 0.23
202 0.28
203 0.29
204 0.3
205 0.3
206 0.33
207 0.31
208 0.28
209 0.28
210 0.26
211 0.25
212 0.25
213 0.25
214 0.27
215 0.27
216 0.27
217 0.26
218 0.26
219 0.35
220 0.43
221 0.47
222 0.5
223 0.6
224 0.65
225 0.68
226 0.69
227 0.64
228 0.6
229 0.58
230 0.5
231 0.43
232 0.36
233 0.3
234 0.26
235 0.21
236 0.15
237 0.12
238 0.1
239 0.07
240 0.07
241 0.08
242 0.09
243 0.09
244 0.09
245 0.09
246 0.12
247 0.15
248 0.15
249 0.15
250 0.14
251 0.14
252 0.14
253 0.14
254 0.13
255 0.11
256 0.09
257 0.08
258 0.08
259 0.13
260 0.17
261 0.19
262 0.23
263 0.23
264 0.26
265 0.3
266 0.35
267 0.31