Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1W6T9

Protein Details
Accession K1W6T9    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-48MARPKKKTAPKPKAPAVAKTKKKTAPKPKAPKKVVRGARKTKSPREDVBasic
NLS Segment(s)
PositionSequence
3-44RPKKKTAPKPKAPAVAKTKKKTAPKPKAPKKVVRGARKTKSP
Subcellular Location(s) nucl 10, cyto_nucl 9.833, mito_nucl 9.833, mito 8.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045518  2EXR  
KEGG mbe:MBM_08954  -  
Pfam View protein in Pfam  
PF20150  2EXR  
Amino Acid Sequences MARPKKKTAPKPKAPAVAKTKKKTAPKPKAPKKVVRGARKTKSPREDVWANRSFTLFPKLPIELRAMIFDLAAMEDSAPKVVRIFHSGKENSDESVVSAGKSRAKAFYKIPAVLHVNNESRTRMLKKNELAFSANLGGAPVYFNYSCDILVFETWVALRCFFTPEDENGARASLPATKMPLDKKIKVVGLMNRAWRSIVMAPSIFVQALGNPDKLLLLRKAYDVHSHDNMTVQYLQTGRLGNYVFSADTEEPYQAPEITLSSMAEMCTTFNVPTVPTWERGKKDGVDRPMVTLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.81
4 0.8
5 0.8
6 0.77
7 0.77
8 0.75
9 0.81
10 0.82
11 0.83
12 0.83
13 0.84
14 0.89
15 0.91
16 0.94
17 0.93
18 0.92
19 0.89
20 0.88
21 0.86
22 0.86
23 0.86
24 0.85
25 0.84
26 0.85
27 0.85
28 0.85
29 0.84
30 0.8
31 0.73
32 0.7
33 0.71
34 0.67
35 0.67
36 0.64
37 0.57
38 0.51
39 0.49
40 0.42
41 0.36
42 0.37
43 0.28
44 0.23
45 0.25
46 0.26
47 0.26
48 0.27
49 0.28
50 0.24
51 0.23
52 0.23
53 0.2
54 0.18
55 0.16
56 0.14
57 0.11
58 0.07
59 0.07
60 0.05
61 0.04
62 0.05
63 0.06
64 0.07
65 0.07
66 0.07
67 0.07
68 0.09
69 0.11
70 0.17
71 0.19
72 0.21
73 0.3
74 0.31
75 0.32
76 0.35
77 0.34
78 0.28
79 0.26
80 0.23
81 0.14
82 0.16
83 0.15
84 0.1
85 0.12
86 0.13
87 0.15
88 0.17
89 0.17
90 0.21
91 0.24
92 0.27
93 0.27
94 0.34
95 0.35
96 0.36
97 0.35
98 0.32
99 0.34
100 0.32
101 0.32
102 0.28
103 0.26
104 0.26
105 0.27
106 0.23
107 0.2
108 0.23
109 0.25
110 0.27
111 0.29
112 0.33
113 0.37
114 0.43
115 0.44
116 0.42
117 0.39
118 0.33
119 0.3
120 0.25
121 0.2
122 0.12
123 0.1
124 0.08
125 0.06
126 0.06
127 0.04
128 0.06
129 0.05
130 0.06
131 0.07
132 0.08
133 0.07
134 0.07
135 0.08
136 0.06
137 0.06
138 0.06
139 0.05
140 0.05
141 0.05
142 0.07
143 0.07
144 0.07
145 0.07
146 0.07
147 0.1
148 0.1
149 0.12
150 0.12
151 0.13
152 0.2
153 0.19
154 0.19
155 0.18
156 0.18
157 0.15
158 0.13
159 0.12
160 0.08
161 0.09
162 0.09
163 0.11
164 0.12
165 0.15
166 0.17
167 0.26
168 0.29
169 0.3
170 0.33
171 0.36
172 0.35
173 0.34
174 0.36
175 0.32
176 0.33
177 0.34
178 0.36
179 0.33
180 0.32
181 0.3
182 0.25
183 0.23
184 0.2
185 0.19
186 0.15
187 0.14
188 0.15
189 0.15
190 0.16
191 0.13
192 0.1
193 0.08
194 0.07
195 0.11
196 0.13
197 0.13
198 0.12
199 0.12
200 0.12
201 0.13
202 0.16
203 0.14
204 0.14
205 0.15
206 0.17
207 0.19
208 0.21
209 0.27
210 0.28
211 0.31
212 0.32
213 0.32
214 0.31
215 0.31
216 0.29
217 0.25
218 0.22
219 0.16
220 0.15
221 0.15
222 0.15
223 0.16
224 0.17
225 0.14
226 0.17
227 0.17
228 0.15
229 0.16
230 0.16
231 0.13
232 0.12
233 0.16
234 0.13
235 0.14
236 0.15
237 0.15
238 0.14
239 0.15
240 0.17
241 0.12
242 0.12
243 0.1
244 0.1
245 0.11
246 0.12
247 0.1
248 0.1
249 0.11
250 0.1
251 0.1
252 0.1
253 0.09
254 0.1
255 0.11
256 0.1
257 0.11
258 0.12
259 0.12
260 0.14
261 0.19
262 0.2
263 0.23
264 0.31
265 0.37
266 0.4
267 0.42
268 0.47
269 0.46
270 0.53
271 0.57
272 0.56
273 0.58
274 0.55