Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZYP2

Protein Details
Accession A0A4P9ZYP2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
144-163KRQQIRQATKTKTTSKKKSQHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, mito 4, E.R. 3, extr 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR026721  TMEM18  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF14770  TMEM18  
Amino Acid Sequences MANLVPPGWELGSLAYKDLLLLMQTYWTEFQADAQEFYQAVNWSQPWLRAWAVFYGGLVVATVYYRGDEGRLAALFITLSIMVLGAQPLNTLAAGYWSDFSDANYFQEHGHFISLVYSIPLLLLLLTVLVMLIFHAGSRLIQVKRQQIRQATKTKTTSKKKSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.13
4 0.13
5 0.13
6 0.1
7 0.06
8 0.07
9 0.06
10 0.08
11 0.08
12 0.1
13 0.1
14 0.1
15 0.11
16 0.1
17 0.12
18 0.16
19 0.17
20 0.17
21 0.17
22 0.17
23 0.16
24 0.17
25 0.18
26 0.12
27 0.12
28 0.13
29 0.13
30 0.14
31 0.15
32 0.17
33 0.14
34 0.17
35 0.17
36 0.16
37 0.17
38 0.15
39 0.16
40 0.14
41 0.13
42 0.1
43 0.09
44 0.08
45 0.06
46 0.05
47 0.03
48 0.03
49 0.04
50 0.03
51 0.03
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.07
58 0.06
59 0.06
60 0.06
61 0.06
62 0.05
63 0.05
64 0.05
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.04
81 0.05
82 0.05
83 0.06
84 0.06
85 0.07
86 0.07
87 0.08
88 0.09
89 0.1
90 0.11
91 0.11
92 0.11
93 0.11
94 0.12
95 0.12
96 0.1
97 0.1
98 0.09
99 0.08
100 0.08
101 0.08
102 0.07
103 0.07
104 0.06
105 0.05
106 0.05
107 0.05
108 0.04
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.03
120 0.03
121 0.03
122 0.04
123 0.04
124 0.04
125 0.07
126 0.14
127 0.15
128 0.21
129 0.27
130 0.37
131 0.44
132 0.52
133 0.56
134 0.59
135 0.67
136 0.71
137 0.74
138 0.71
139 0.73
140 0.73
141 0.76
142 0.77
143 0.79