Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZUM5

Protein Details
Accession A0A4P9ZUM5   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
90-113NDTTWKIYCQRQKQIREDFQQKKKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.5, nucl 10, cyto 9, pero 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007854  Fip1_dom  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF05182  Fip1  
Amino Acid Sequences MDPPNEASAPESNKAEASTATTTTAPASNSVIAPATASSTEIVRKGGLSLDTVGQFNGQDIYDYDIDGADDKPWNRPGADITDYFNYGLNDTTWKIYCQRQKQIREDFQQKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.17
4 0.17
5 0.16
6 0.16
7 0.17
8 0.16
9 0.16
10 0.16
11 0.18
12 0.13
13 0.12
14 0.13
15 0.12
16 0.12
17 0.13
18 0.12
19 0.1
20 0.09
21 0.08
22 0.08
23 0.06
24 0.07
25 0.07
26 0.07
27 0.09
28 0.09
29 0.09
30 0.08
31 0.08
32 0.08
33 0.09
34 0.09
35 0.08
36 0.08
37 0.09
38 0.1
39 0.1
40 0.09
41 0.08
42 0.08
43 0.07
44 0.07
45 0.05
46 0.05
47 0.05
48 0.08
49 0.08
50 0.08
51 0.08
52 0.07
53 0.07
54 0.08
55 0.08
56 0.06
57 0.09
58 0.09
59 0.13
60 0.16
61 0.17
62 0.16
63 0.17
64 0.18
65 0.21
66 0.24
67 0.21
68 0.21
69 0.22
70 0.23
71 0.22
72 0.22
73 0.17
74 0.14
75 0.14
76 0.12
77 0.12
78 0.13
79 0.16
80 0.15
81 0.16
82 0.2
83 0.27
84 0.36
85 0.43
86 0.52
87 0.58
88 0.66
89 0.74
90 0.81
91 0.82
92 0.83
93 0.84