Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9ZRQ2

Protein Details
Accession A0A4P9ZRQ2    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-30LERNRIAASKCRQKKKQWIEELKTQSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
IPR002112  Leuzip_Jun  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14687  bZIP_ATF2  
Amino Acid Sequences RKRFLERNRIAASKCRQKKKQWIEELKTQSEVAVQRNKQLTYMIGQLRDEVLTLKNQLLAHRDC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.66
3 0.68
4 0.73
5 0.82
6 0.84
7 0.85
8 0.85
9 0.86
10 0.81
11 0.83
12 0.79
13 0.7
14 0.6
15 0.49
16 0.38
17 0.31
18 0.27
19 0.22
20 0.23
21 0.22
22 0.26
23 0.29
24 0.29
25 0.26
26 0.25
27 0.22
28 0.17
29 0.24
30 0.21
31 0.2
32 0.2
33 0.2
34 0.2
35 0.19
36 0.16
37 0.11
38 0.1
39 0.12
40 0.13
41 0.13
42 0.17
43 0.18
44 0.21