Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q0A1A9

Protein Details
Accession A0A4Q0A1A9    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-49VAPRKTVTIVKKRSKPFLRHQSDRYKTVKASWRKPKGIDNRVRRRFRGHydrophilic
NLS Segment(s)
PositionSequence
12-48KKRSKPFLRHQSDRYKTVKASWRKPKGIDNRVRRRFR
Subcellular Location(s) mito 17, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAPRKTVTIVKKRSKPFLRHQSDRYKTVKASWRKPKGIDNRVRRRFRGQLPMPSIGYGSNKKTRHVLPCGFKKAIVNNLKDLESLMVCNKTYAAQIAHSVSAKSRAEIIQRAQELDVHVLNRSARLRTEEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.8
4 0.8
5 0.81
6 0.81
7 0.8
8 0.82
9 0.82
10 0.79
11 0.77
12 0.7
13 0.64
14 0.55
15 0.55
16 0.56
17 0.54
18 0.58
19 0.62
20 0.68
21 0.68
22 0.7
23 0.71
24 0.73
25 0.74
26 0.74
27 0.74
28 0.76
29 0.81
30 0.83
31 0.77
32 0.73
33 0.7
34 0.67
35 0.67
36 0.62
37 0.6
38 0.6
39 0.6
40 0.53
41 0.45
42 0.38
43 0.29
44 0.26
45 0.2
46 0.2
47 0.24
48 0.25
49 0.26
50 0.3
51 0.33
52 0.35
53 0.39
54 0.41
55 0.41
56 0.48
57 0.53
58 0.49
59 0.45
60 0.42
61 0.38
62 0.41
63 0.39
64 0.33
65 0.31
66 0.32
67 0.32
68 0.3
69 0.27
70 0.19
71 0.13
72 0.12
73 0.11
74 0.11
75 0.1
76 0.11
77 0.1
78 0.1
79 0.1
80 0.12
81 0.11
82 0.1
83 0.12
84 0.14
85 0.15
86 0.15
87 0.15
88 0.14
89 0.2
90 0.19
91 0.17
92 0.19
93 0.2
94 0.23
95 0.28
96 0.31
97 0.32
98 0.33
99 0.34
100 0.31
101 0.3
102 0.28
103 0.26
104 0.25
105 0.18
106 0.18
107 0.19
108 0.19
109 0.22
110 0.23
111 0.22
112 0.23