Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZY97

Protein Details
Accession A0A4P9ZY97    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
57-81EAELRKSTTTKKKNKAKETNSYTSAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 23, mito 1, pero 1, E.R. 1, golg 1
Family & Domain DBs
Amino Acid Sequences MHLRLIVPLLLVFTANALTQSYTSDLDRRSTAGVLALPLQSRTLNSEPPSAEYLAAEAELRKSTTTKKKNKAKETNSYTSAGATNTPPFLFAALTGLAVAYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.07
4 0.06
5 0.07
6 0.07
7 0.08
8 0.1
9 0.11
10 0.12
11 0.16
12 0.16
13 0.18
14 0.19
15 0.18
16 0.18
17 0.16
18 0.15
19 0.13
20 0.12
21 0.1
22 0.11
23 0.1
24 0.09
25 0.09
26 0.1
27 0.09
28 0.09
29 0.13
30 0.13
31 0.16
32 0.17
33 0.2
34 0.2
35 0.22
36 0.23
37 0.18
38 0.17
39 0.13
40 0.12
41 0.08
42 0.08
43 0.06
44 0.05
45 0.05
46 0.06
47 0.06
48 0.07
49 0.08
50 0.16
51 0.26
52 0.36
53 0.45
54 0.55
55 0.64
56 0.74
57 0.84
58 0.87
59 0.84
60 0.85
61 0.84
62 0.8
63 0.74
64 0.66
65 0.55
66 0.46
67 0.39
68 0.29
69 0.22
70 0.17
71 0.16
72 0.16
73 0.15
74 0.15
75 0.14
76 0.14
77 0.12
78 0.1
79 0.11
80 0.09
81 0.09
82 0.08