Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9ZPV4

Protein Details
Accession A0A4P9ZPV4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-100GNELVKKYRQSRDQKKAAKAAGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, mito 2, cyto 1, plas 1, pero 1, mito_nucl 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MKLLSSLALVLAAIGTVSMVHANPTTAEDSTGHQPHLQKRWFRSGLTRVGAGLAGAAAGSALLPGVGTVIGGIGGLYGGNELVKKYRQSRDQKKAAKAAGQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.02
4 0.03
5 0.04
6 0.04
7 0.05
8 0.06
9 0.06
10 0.07
11 0.09
12 0.11
13 0.1
14 0.11
15 0.11
16 0.14
17 0.2
18 0.21
19 0.2
20 0.2
21 0.25
22 0.3
23 0.37
24 0.4
25 0.38
26 0.41
27 0.5
28 0.5
29 0.46
30 0.47
31 0.44
32 0.45
33 0.41
34 0.37
35 0.27
36 0.25
37 0.24
38 0.17
39 0.11
40 0.04
41 0.03
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.01
48 0.01
49 0.01
50 0.01
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.03
66 0.03
67 0.04
68 0.05
69 0.08
70 0.13
71 0.18
72 0.26
73 0.34
74 0.43
75 0.54
76 0.65
77 0.72
78 0.79
79 0.82
80 0.84
81 0.84
82 0.79