Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q0A314

Protein Details
Accession A0A4Q0A314   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-50RGLPSSLPHKRKRSSRNSKHNVRKLVIHydrophilic
NLS Segment(s)
PositionSequence
32-42HKRKRSSRNSK
Subcellular Location(s) nucl 17, cyto_nucl 11.833, cyto_mito 4.666, cyto 4.5, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000095  CRIB_dom  
IPR036936  CRIB_dom_sf  
Pfam View protein in Pfam  
PF00786  PBD  
PROSITE View protein in PROSITE  
PS50108  CRIB  
CDD cd00132  CRIB  
Amino Acid Sequences MTVKMTFAGLFTSCLGYVPNMDQRGLPSSLPHKRKRSSRNSKHNVRKLVISAPTNFRHTTHMGIGGLSTVAPQEMTHGYESIPNNPHDDLSFSPPLYPCKRMSLRPSLGSSSIDLPASHMTYKVPQQPLNLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.1
4 0.12
5 0.14
6 0.2
7 0.2
8 0.2
9 0.21
10 0.22
11 0.26
12 0.26
13 0.22
14 0.19
15 0.27
16 0.35
17 0.43
18 0.5
19 0.54
20 0.6
21 0.69
22 0.76
23 0.78
24 0.81
25 0.83
26 0.86
27 0.87
28 0.91
29 0.92
30 0.89
31 0.85
32 0.75
33 0.67
34 0.58
35 0.53
36 0.47
37 0.39
38 0.33
39 0.32
40 0.33
41 0.33
42 0.31
43 0.27
44 0.26
45 0.25
46 0.24
47 0.2
48 0.19
49 0.16
50 0.15
51 0.14
52 0.1
53 0.09
54 0.06
55 0.05
56 0.03
57 0.03
58 0.03
59 0.03
60 0.05
61 0.05
62 0.07
63 0.08
64 0.08
65 0.08
66 0.13
67 0.14
68 0.18
69 0.2
70 0.19
71 0.21
72 0.21
73 0.21
74 0.17
75 0.19
76 0.16
77 0.19
78 0.21
79 0.18
80 0.2
81 0.22
82 0.28
83 0.29
84 0.31
85 0.27
86 0.34
87 0.38
88 0.42
89 0.48
90 0.51
91 0.53
92 0.54
93 0.56
94 0.5
95 0.47
96 0.42
97 0.37
98 0.29
99 0.25
100 0.21
101 0.17
102 0.17
103 0.18
104 0.19
105 0.18
106 0.15
107 0.16
108 0.19
109 0.26
110 0.32
111 0.35
112 0.36