Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZST7

Protein Details
Accession A0A4P9ZST7   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MTNSTRHKKQKTKDFQKVKLKVGQKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
IPR016024  ARM-type_fold  
IPR024679  Ipi1_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0097344  C:Rix1 complex  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF12333  Ipi1_N  
Amino Acid Sequences MTNSTRHKKQKTKDFQKVKLKVGQKKQAAANHTDTSFRSQAIVLTGQNLHADRANQQTNARNLTLTDLVPQLKHYNGVVKRDALHGLNDLVKQHPAVIGEQLGVLVNSLVRLFVDDEPVIRKLVRGFCVDHFRALPESKLAAFYPIILAYTNSAMTHIDEEIRIDGLKLLNTWIEILPRYMGQYKQKIIPEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.92
4 0.89
5 0.85
6 0.82
7 0.79
8 0.78
9 0.78
10 0.77
11 0.71
12 0.7
13 0.7
14 0.67
15 0.62
16 0.58
17 0.54
18 0.48
19 0.44
20 0.4
21 0.34
22 0.35
23 0.32
24 0.26
25 0.21
26 0.17
27 0.18
28 0.18
29 0.19
30 0.13
31 0.14
32 0.14
33 0.14
34 0.16
35 0.15
36 0.14
37 0.13
38 0.14
39 0.14
40 0.21
41 0.23
42 0.23
43 0.26
44 0.31
45 0.33
46 0.36
47 0.33
48 0.26
49 0.24
50 0.25
51 0.23
52 0.17
53 0.15
54 0.14
55 0.14
56 0.14
57 0.15
58 0.14
59 0.12
60 0.13
61 0.12
62 0.18
63 0.2
64 0.24
65 0.24
66 0.24
67 0.24
68 0.25
69 0.26
70 0.19
71 0.17
72 0.13
73 0.13
74 0.14
75 0.13
76 0.12
77 0.11
78 0.11
79 0.1
80 0.09
81 0.09
82 0.08
83 0.07
84 0.07
85 0.07
86 0.07
87 0.06
88 0.06
89 0.05
90 0.04
91 0.04
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.04
99 0.06
100 0.06
101 0.09
102 0.09
103 0.1
104 0.12
105 0.13
106 0.13
107 0.11
108 0.12
109 0.13
110 0.18
111 0.2
112 0.2
113 0.22
114 0.25
115 0.34
116 0.33
117 0.31
118 0.27
119 0.25
120 0.27
121 0.25
122 0.22
123 0.15
124 0.16
125 0.15
126 0.16
127 0.15
128 0.13
129 0.12
130 0.12
131 0.11
132 0.1
133 0.1
134 0.09
135 0.09
136 0.08
137 0.09
138 0.09
139 0.08
140 0.08
141 0.09
142 0.09
143 0.1
144 0.1
145 0.1
146 0.09
147 0.11
148 0.11
149 0.11
150 0.1
151 0.09
152 0.11
153 0.11
154 0.12
155 0.11
156 0.12
157 0.11
158 0.12
159 0.13
160 0.12
161 0.13
162 0.13
163 0.14
164 0.15
165 0.15
166 0.18
167 0.21
168 0.26
169 0.32
170 0.39
171 0.43
172 0.48