FuNGI

A0A4V1J4Z5

Protein Details

Accession

A0A4V1J4Z5

Localization Confidence

Medium

Confidence Score

11.1

NoLS Segment(s)

Position	Sequence	Protein Nature
39-66	KPPATHPWASRDRRRERLERKRRAAYAS	Basic

NLS Segment(s)

Position	Sequence
48-61	SRDRRRERLERKRR

Subcellular Location(s)

nucl 11, cyto_nucl 11, cyto 9, mito 5

Family & Domain DBs

InterPro	View protein in InterPro IPR027450 AlkB-like IPR037151 AlkB-like_sf IPR032857 ALKBH4 IPR005123 Oxoglu/Fe-dep_dioxygenase
Gene Ontology	GO:0070988 P:demethylation
Pfam	View protein in Pfam PF13532 2OG-FeII_Oxy_2
PROSITE	View protein in PROSITE PS51471 FE2OG_OXY

Amino Acid Sequences

MTPDSSNLVTSPAPPKLVQPTQPINRENEPPTGLLSPTKPPATHPWASRDRRRERLERKRRAAYASVAKVENLPDCSTLFTPKPTPILCLVNVGYGGITGVTIEQLEGVLVPCPGFVQVVMNHGKPYTFVIFSDAQTAATACASLHEQPSELLLKRTLFAEHIPLKITSFTMPLRTQIEQILNCRNSPNPIVTLETDHTMHVQFPATASLRSLYERLQAKGLYCFDDFVTPEEEQEILGQADEHDFESWIEVNGRCVQHYGHIFDYKTKQVGNPDAAIDRQFPGIIQNILQRLHQLPIFTPANDSPAPSPDALNHTGTRLPLRLPQLNQLTISKYPIGSGISFHSDSHVSFTDVLVVVSLASPITMEFRSPFYAMRDQLHSRDAALQPIPTGSGGGGGSVPPGDPQPILPNPVFIDLAPRSLTVMSGEIRYGWEHSIRARKSDLLFASGAIRPRQFRVSLTVREVSEHRTCTCPWAELCDRSTETTE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.26
2	0.31
3	0.37
4	0.43
5	0.45
6	0.47
7	0.54
8	0.6
9	0.67
10	0.66
11	0.63
12	0.61
13	0.62
14	0.57
15	0.52
16	0.46
17	0.39
18	0.38
19	0.34
20	0.3
21	0.27
22	0.27
23	0.27
24	0.3
25	0.33
26	0.3
27	0.33
28	0.41
29	0.45
30	0.49
31	0.48
32	0.51
33	0.58
34	0.66
35	0.72
36	0.73
37	0.74
38	0.77
39	0.81
40	0.83
41	0.84
42	0.87
43	0.88
44	0.89
45	0.89
46	0.88
47	0.84
48	0.79
49	0.73
50	0.7
51	0.69
52	0.64
53	0.59
54	0.5
55	0.46
56	0.41
57	0.39
58	0.33
59	0.26
60	0.22
61	0.19
62	0.18
63	0.21
64	0.21
65	0.24
66	0.22
67	0.23
68	0.25
69	0.26
70	0.32
71	0.29
72	0.31
73	0.3
74	0.33
75	0.29
76	0.3
77	0.28
78	0.23
79	0.23
80	0.2
81	0.15
82	0.1
83	0.1
84	0.05
85	0.04
86	0.03
87	0.03
88	0.04
89	0.04
90	0.04
91	0.04
92	0.04
93	0.04
94	0.04
95	0.04
96	0.05
97	0.05
98	0.05
99	0.05
100	0.05
101	0.06
102	0.06
103	0.05
104	0.08
105	0.09
106	0.15
107	0.18
108	0.18
109	0.19
110	0.19
111	0.19
112	0.16
113	0.19
114	0.16
115	0.14
116	0.13
117	0.17
118	0.19
119	0.19
120	0.22
121	0.18
122	0.16
123	0.15
124	0.15
125	0.11
126	0.09
127	0.09
128	0.05
129	0.06
130	0.07
131	0.09
132	0.1
133	0.1
134	0.11
135	0.11
136	0.13
137	0.16
138	0.15
139	0.15
140	0.16
141	0.16
142	0.16
143	0.17
144	0.15
145	0.13
146	0.13
147	0.19
148	0.2
149	0.2
150	0.21
151	0.21
152	0.21
153	0.2
154	0.2
155	0.13
156	0.13
157	0.13
158	0.16
159	0.16
160	0.18
161	0.21
162	0.21
163	0.21
164	0.22
165	0.26
166	0.23
167	0.26
168	0.31
169	0.29
170	0.28
171	0.29
172	0.26
173	0.24
174	0.24
175	0.23
176	0.16
177	0.16
178	0.18
179	0.17
180	0.19
181	0.17
182	0.17
183	0.16
184	0.14
185	0.14
186	0.12
187	0.12
188	0.09
189	0.09
190	0.07
191	0.07
192	0.11
193	0.11
194	0.1
195	0.1
196	0.1
197	0.11
198	0.12
199	0.12
200	0.1
201	0.15
202	0.18
203	0.18
204	0.19
205	0.19
206	0.19
207	0.22
208	0.22
209	0.19
210	0.16
211	0.16
212	0.14
213	0.15
214	0.14
215	0.12
216	0.14
217	0.11
218	0.11
219	0.11
220	0.11
221	0.09
222	0.09
223	0.08
224	0.05
225	0.05
226	0.05
227	0.04
228	0.05
229	0.05
230	0.05
231	0.05
232	0.05
233	0.05
234	0.06
235	0.06
236	0.06
237	0.08
238	0.07
239	0.09
240	0.13
241	0.13
242	0.13
243	0.13
244	0.13
245	0.16
246	0.18
247	0.18
248	0.16
249	0.19
250	0.19
251	0.22
252	0.25
253	0.23
254	0.22
255	0.2
256	0.19
257	0.2
258	0.24
259	0.23
260	0.21
261	0.2
262	0.19
263	0.19
264	0.19
265	0.16
266	0.12
267	0.1
268	0.09
269	0.08
270	0.09
271	0.1
272	0.1
273	0.1
274	0.12
275	0.14
276	0.15
277	0.15
278	0.15
279	0.14
280	0.16
281	0.15
282	0.13
283	0.11
284	0.17
285	0.19
286	0.17
287	0.18
288	0.16
289	0.2
290	0.19
291	0.2
292	0.14
293	0.15
294	0.17
295	0.15
296	0.15
297	0.13
298	0.17
299	0.19
300	0.2
301	0.19
302	0.18
303	0.19
304	0.2
305	0.2
306	0.16
307	0.15
308	0.17
309	0.23
310	0.26
311	0.26
312	0.33
313	0.36
314	0.36
315	0.36
316	0.33
317	0.3
318	0.26
319	0.27
320	0.21
321	0.16
322	0.15
323	0.15
324	0.15
325	0.12
326	0.12
327	0.12
328	0.16
329	0.16
330	0.16
331	0.16
332	0.16
333	0.16
334	0.18
335	0.17
336	0.14
337	0.13
338	0.13
339	0.14
340	0.14
341	0.13
342	0.1
343	0.08
344	0.07
345	0.07
346	0.07
347	0.04
348	0.03
349	0.03
350	0.04
351	0.06
352	0.06
353	0.07
354	0.08
355	0.11
356	0.14
357	0.15
358	0.16
359	0.18
360	0.25
361	0.26
362	0.28
363	0.32
364	0.33
365	0.34
366	0.35
367	0.3
368	0.25
369	0.29
370	0.27
371	0.25
372	0.23
373	0.21
374	0.2
375	0.2
376	0.19
377	0.12
378	0.12
379	0.07
380	0.08
381	0.08
382	0.08
383	0.08
384	0.07
385	0.07
386	0.07
387	0.07
388	0.06
389	0.07
390	0.08
391	0.08
392	0.1
393	0.16
394	0.18
395	0.23
396	0.22
397	0.24
398	0.23
399	0.26
400	0.25
401	0.17
402	0.22
403	0.19
404	0.21
405	0.2
406	0.19
407	0.17
408	0.17
409	0.18
410	0.12
411	0.14
412	0.12
413	0.13
414	0.13
415	0.12
416	0.13
417	0.14
418	0.15
419	0.15
420	0.16
421	0.17
422	0.23
423	0.33
424	0.33
425	0.36
426	0.37
427	0.4
428	0.4
429	0.46
430	0.41
431	0.35
432	0.33
433	0.3
434	0.31
435	0.28
436	0.3
437	0.27
438	0.29
439	0.28
440	0.31
441	0.36
442	0.34
443	0.33
444	0.38
445	0.42
446	0.44
447	0.47
448	0.49
449	0.43
450	0.45
451	0.44
452	0.42
453	0.41
454	0.38
455	0.35
456	0.34
457	0.34
458	0.37
459	0.38
460	0.37
461	0.31
462	0.37
463	0.41
464	0.43
465	0.44
466	0.45
467	0.44

A0A4V1J4Z5

3D AlphaFold-predicted Structure Viewer