Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZWB7

Protein Details
Accession A0A4P9ZWB7   
Localization Confidence High
Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAKSGRSKSKIQSRNIRREVIHydrophilic
71-114EDNTTKSKKNKDDKYKGLRGCEIKRRRKEATKKLRLAKKAARRABasic
NLS Segment(s)
PositionSequence
78-116KKNKDDKYKGLRGCEIKRRRKEATKKLRLAKKAARRAGK
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSGRSKSKIQSRNIRREVIYGPKEAERLLRLATKQADCANAPSSMSGVVEDEVAEVSSDKVDEDVPMDEDNTTKSKKNKDDKYKGLRGCEIKRRRKEATKKLRLAKKAARRAGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.77
4 0.67
5 0.63
6 0.59
7 0.58
8 0.51
9 0.42
10 0.38
11 0.35
12 0.35
13 0.31
14 0.29
15 0.2
16 0.18
17 0.18
18 0.2
19 0.18
20 0.23
21 0.27
22 0.25
23 0.26
24 0.26
25 0.26
26 0.23
27 0.25
28 0.21
29 0.17
30 0.16
31 0.14
32 0.12
33 0.1
34 0.09
35 0.07
36 0.05
37 0.05
38 0.05
39 0.05
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.03
46 0.03
47 0.04
48 0.03
49 0.04
50 0.04
51 0.04
52 0.05
53 0.06
54 0.07
55 0.07
56 0.08
57 0.07
58 0.07
59 0.09
60 0.11
61 0.12
62 0.16
63 0.21
64 0.29
65 0.38
66 0.49
67 0.57
68 0.65
69 0.74
70 0.79
71 0.84
72 0.85
73 0.79
74 0.74
75 0.7
76 0.67
77 0.65
78 0.65
79 0.66
80 0.67
81 0.73
82 0.75
83 0.77
84 0.8
85 0.83
86 0.84
87 0.85
88 0.86
89 0.86
90 0.88
91 0.88
92 0.84
93 0.82
94 0.81
95 0.8
96 0.8