Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q0A380

Protein Details
Accession A0A4Q0A380    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-24GRQHPPTHSRPYRPREKPISSHBasic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029704  STEEP-like  
Amino Acid Sequences MAGRQHPPTHSRPYRPREKPISSHVYYCLCGEYNLILVSTKPLSDFPQRITDSAYIIDNTQIKHSWNAKRGETVLLKRSDGYEQQERYHCRRCDLLVGYKATGESHSGDYSYILATALTEAPGAVPVALQNEVKSSLGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.79
3 0.83
4 0.82
5 0.81
6 0.77
7 0.76
8 0.75
9 0.67
10 0.61
11 0.56
12 0.49
13 0.42
14 0.36
15 0.29
16 0.21
17 0.18
18 0.17
19 0.13
20 0.11
21 0.11
22 0.1
23 0.08
24 0.08
25 0.1
26 0.1
27 0.09
28 0.08
29 0.09
30 0.13
31 0.2
32 0.22
33 0.22
34 0.3
35 0.31
36 0.31
37 0.32
38 0.29
39 0.23
40 0.22
41 0.2
42 0.12
43 0.11
44 0.13
45 0.12
46 0.11
47 0.12
48 0.12
49 0.12
50 0.17
51 0.24
52 0.27
53 0.32
54 0.35
55 0.34
56 0.35
57 0.35
58 0.34
59 0.32
60 0.3
61 0.29
62 0.27
63 0.27
64 0.25
65 0.25
66 0.23
67 0.21
68 0.24
69 0.25
70 0.25
71 0.29
72 0.34
73 0.38
74 0.42
75 0.49
76 0.44
77 0.39
78 0.4
79 0.38
80 0.39
81 0.39
82 0.41
83 0.37
84 0.38
85 0.36
86 0.33
87 0.32
88 0.25
89 0.21
90 0.15
91 0.12
92 0.13
93 0.13
94 0.13
95 0.13
96 0.13
97 0.13
98 0.11
99 0.09
100 0.06
101 0.06
102 0.05
103 0.07
104 0.07
105 0.06
106 0.06
107 0.06
108 0.06
109 0.07
110 0.07
111 0.05
112 0.05
113 0.06
114 0.08
115 0.11
116 0.11
117 0.11
118 0.13
119 0.15