Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZZK5

Protein Details
Accession A0A4P9ZZK5    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
97-129GQAETIKVSRKQRKERKNRAKKLRGTAKTKAAGHydrophilic
NLS Segment(s)
PositionSequence
103-133KVSRKQRKERKNRAKKLRGTAKTKAAGKDKK
Subcellular Location(s) mito 19, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADSSLVTLRTRKFMTNRLLQRKQMIVDVLHPGLSNLSKVDIRERLGKLYKADKECVFVFGMRNQFGGGKSSGFALIYDSLKSAQSFEPKYRMVRHGQAETIKVSRKQRKERKNRAKKLRGTAKTKAAGKDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.48
3 0.54
4 0.62
5 0.66
6 0.71
7 0.68
8 0.68
9 0.63
10 0.57
11 0.5
12 0.42
13 0.32
14 0.29
15 0.29
16 0.24
17 0.21
18 0.19
19 0.16
20 0.15
21 0.14
22 0.12
23 0.08
24 0.1
25 0.1
26 0.11
27 0.16
28 0.18
29 0.2
30 0.26
31 0.27
32 0.3
33 0.33
34 0.35
35 0.33
36 0.37
37 0.41
38 0.37
39 0.4
40 0.35
41 0.34
42 0.32
43 0.31
44 0.24
45 0.18
46 0.17
47 0.17
48 0.19
49 0.16
50 0.16
51 0.14
52 0.15
53 0.14
54 0.15
55 0.11
56 0.09
57 0.08
58 0.09
59 0.09
60 0.08
61 0.07
62 0.06
63 0.08
64 0.08
65 0.08
66 0.08
67 0.09
68 0.1
69 0.1
70 0.1
71 0.11
72 0.17
73 0.19
74 0.21
75 0.26
76 0.27
77 0.31
78 0.34
79 0.36
80 0.35
81 0.39
82 0.42
83 0.39
84 0.41
85 0.4
86 0.37
87 0.36
88 0.34
89 0.32
90 0.33
91 0.4
92 0.46
93 0.53
94 0.63
95 0.7
96 0.78
97 0.84
98 0.9
99 0.92
100 0.94
101 0.95
102 0.95
103 0.95
104 0.93
105 0.92
106 0.92
107 0.89
108 0.86
109 0.83
110 0.81
111 0.79
112 0.75
113 0.72