Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1WQ44

Protein Details
Accession K1WQ44    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
73-94RATNGKSKKNRAKKVKLSTVVEHydrophilic
113-143MSGLKKRDRSKAKEKLKAKKRKQQGAAGVAGHydrophilic
NLS Segment(s)
PositionSequence
77-87GKSKKNRAKKV
116-139LKKRDRSKAKEKLKAKKRKQQGAA
Subcellular Location(s) nucl 15, cyto_nucl 12.5, cyto 8, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG mbe:MBM_06867  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MSRGHLSNGDFFLRLSELFDERRKKDHGSIFLVQKRMSYGEEADDDDSPATKTETERPFPDQSPSKPLPIIIRATNGKSKKNRAKKVKLSTVVEADALEAFFAKYAEVCKLGMSGLKKRDRSKAKEKLKAKKRKQQGAAGVAGAEAKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.15
4 0.16
5 0.2
6 0.28
7 0.34
8 0.35
9 0.4
10 0.42
11 0.43
12 0.48
13 0.52
14 0.51
15 0.51
16 0.54
17 0.58
18 0.59
19 0.58
20 0.5
21 0.42
22 0.37
23 0.31
24 0.26
25 0.19
26 0.16
27 0.15
28 0.16
29 0.17
30 0.17
31 0.15
32 0.15
33 0.13
34 0.12
35 0.1
36 0.09
37 0.08
38 0.08
39 0.09
40 0.17
41 0.22
42 0.25
43 0.27
44 0.32
45 0.35
46 0.35
47 0.39
48 0.36
49 0.33
50 0.38
51 0.37
52 0.33
53 0.3
54 0.3
55 0.27
56 0.24
57 0.25
58 0.18
59 0.2
60 0.2
61 0.22
62 0.27
63 0.27
64 0.3
65 0.33
66 0.42
67 0.48
68 0.57
69 0.65
70 0.69
71 0.76
72 0.8
73 0.84
74 0.84
75 0.81
76 0.74
77 0.67
78 0.59
79 0.49
80 0.39
81 0.29
82 0.2
83 0.14
84 0.1
85 0.07
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.06
93 0.07
94 0.08
95 0.09
96 0.08
97 0.09
98 0.09
99 0.12
100 0.15
101 0.2
102 0.28
103 0.36
104 0.42
105 0.46
106 0.56
107 0.62
108 0.67
109 0.71
110 0.73
111 0.76
112 0.8
113 0.84
114 0.85
115 0.86
116 0.89
117 0.88
118 0.88
119 0.88
120 0.89
121 0.87
122 0.86
123 0.85
124 0.8
125 0.72
126 0.63
127 0.52
128 0.42
129 0.36