Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q0A0A1

Protein Details
Accession A0A4Q0A0A1    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
143-186DERPARRKKTSEPKKAPKVSKPSKSTEKKSKRPKSRKDDDDDIGBasic
211-231SGRAGRRTTRGRRIDYKQFGPHydrophilic
NLS Segment(s)
PositionSequence
72-102AKRREQPAPTRRTAKAPASPPPRRAAAMRPR
145-179RPARRKKTSEPKKAPKVSKPSKSTEKKSKRPKSRK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MDRKRKLEALAAKRRAEQSGEEAPASTQAKTRTRPSAASSTKASSKTTKKRTSTTTSTSSSRRSTSDAVSPAKRREQPAPTRRTAKAPASPPPRRAAAMRPRPANLNEDEYDLDDGFLVASDDEDEGDLTPSESDSEPDFSEDERPARRKKTSEPKKAPKVSKPSKSTEKKSKRPKSRKDDDDDIGLATDESDAEDDLTVMDKSNIISSGSGRAGRRTTRGRRIDYKQFGPDPNDSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.57
3 0.5
4 0.42
5 0.38
6 0.39
7 0.39
8 0.34
9 0.31
10 0.29
11 0.33
12 0.31
13 0.24
14 0.2
15 0.25
16 0.32
17 0.36
18 0.42
19 0.44
20 0.46
21 0.49
22 0.51
23 0.54
24 0.51
25 0.51
26 0.48
27 0.44
28 0.46
29 0.44
30 0.42
31 0.39
32 0.46
33 0.52
34 0.59
35 0.64
36 0.64
37 0.69
38 0.73
39 0.73
40 0.71
41 0.67
42 0.62
43 0.57
44 0.56
45 0.53
46 0.51
47 0.46
48 0.4
49 0.36
50 0.33
51 0.32
52 0.31
53 0.33
54 0.34
55 0.35
56 0.39
57 0.42
58 0.42
59 0.46
60 0.47
61 0.45
62 0.46
63 0.51
64 0.56
65 0.61
66 0.64
67 0.63
68 0.65
69 0.63
70 0.61
71 0.57
72 0.52
73 0.5
74 0.46
75 0.49
76 0.53
77 0.57
78 0.54
79 0.51
80 0.47
81 0.41
82 0.39
83 0.4
84 0.4
85 0.45
86 0.49
87 0.48
88 0.47
89 0.49
90 0.48
91 0.42
92 0.34
93 0.29
94 0.23
95 0.22
96 0.22
97 0.19
98 0.19
99 0.15
100 0.13
101 0.07
102 0.07
103 0.05
104 0.04
105 0.04
106 0.02
107 0.02
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.06
120 0.06
121 0.06
122 0.07
123 0.09
124 0.09
125 0.1
126 0.1
127 0.09
128 0.12
129 0.13
130 0.15
131 0.19
132 0.24
133 0.28
134 0.33
135 0.37
136 0.39
137 0.47
138 0.55
139 0.61
140 0.67
141 0.73
142 0.78
143 0.84
144 0.89
145 0.86
146 0.83
147 0.83
148 0.81
149 0.8
150 0.75
151 0.72
152 0.74
153 0.76
154 0.77
155 0.77
156 0.78
157 0.79
158 0.84
159 0.87
160 0.88
161 0.9
162 0.92
163 0.91
164 0.92
165 0.91
166 0.88
167 0.85
168 0.76
169 0.69
170 0.59
171 0.49
172 0.38
173 0.29
174 0.2
175 0.12
176 0.1
177 0.05
178 0.05
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.05
185 0.07
186 0.07
187 0.07
188 0.07
189 0.07
190 0.08
191 0.1
192 0.11
193 0.1
194 0.11
195 0.11
196 0.16
197 0.18
198 0.23
199 0.22
200 0.26
201 0.3
202 0.33
203 0.4
204 0.46
205 0.53
206 0.58
207 0.66
208 0.7
209 0.74
210 0.79
211 0.82
212 0.8
213 0.77
214 0.75
215 0.73
216 0.7
217 0.66