Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZX93

Protein Details
Accession A0A4P9ZX93    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
100-124LLPLIKRKPKSVKAKKAAQKRQELSHydrophilic
NLS Segment(s)
PositionSequence
105-119KRKPKSVKAKKAAQK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000232  HSF_DNA-bd  
IPR027725  HSF_fam  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
Pfam View protein in Pfam  
PF00447  HSF_DNA-bind  
Amino Acid Sequences MDADSFGFARKLHSSLENPAFRHCVEWDITGRYIVFTDIREYESIVLPCYHKTRTFKSLVRQLHLYGFRRGTDARKIRDSSLLNYCSFHHPLFVRGRMDLLPLIKRKPKSVKAKKAAQKRQELSYSQSALDSPTEQLSYLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.34
3 0.43
4 0.43
5 0.42
6 0.43
7 0.43
8 0.38
9 0.37
10 0.29
11 0.23
12 0.2
13 0.23
14 0.23
15 0.24
16 0.24
17 0.22
18 0.22
19 0.19
20 0.17
21 0.14
22 0.13
23 0.1
24 0.12
25 0.12
26 0.14
27 0.13
28 0.14
29 0.14
30 0.16
31 0.16
32 0.14
33 0.14
34 0.14
35 0.16
36 0.18
37 0.19
38 0.21
39 0.25
40 0.29
41 0.34
42 0.4
43 0.42
44 0.46
45 0.52
46 0.5
47 0.48
48 0.45
49 0.39
50 0.38
51 0.4
52 0.35
53 0.3
54 0.28
55 0.25
56 0.26
57 0.26
58 0.23
59 0.27
60 0.3
61 0.3
62 0.35
63 0.36
64 0.35
65 0.41
66 0.4
67 0.34
68 0.35
69 0.34
70 0.29
71 0.29
72 0.29
73 0.27
74 0.27
75 0.23
76 0.2
77 0.18
78 0.23
79 0.27
80 0.3
81 0.27
82 0.24
83 0.26
84 0.23
85 0.24
86 0.2
87 0.18
88 0.2
89 0.22
90 0.27
91 0.31
92 0.33
93 0.39
94 0.47
95 0.54
96 0.59
97 0.67
98 0.73
99 0.76
100 0.85
101 0.85
102 0.87
103 0.87
104 0.85
105 0.84
106 0.77
107 0.75
108 0.71
109 0.65
110 0.61
111 0.58
112 0.51
113 0.41
114 0.38
115 0.31
116 0.27
117 0.26
118 0.21
119 0.15
120 0.15
121 0.15