Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9ZQC3

Protein Details
Accession A0A4P9ZQC3    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-23TTPPRWPRDGHPSPPRRPRDGBasic
80-100TTPPRWPRDGHPSPPRRPRDGBasic
NLS Segment(s)
PositionSequence
12-98GHPSPPRRPRDGDTAPPRRPRDGGTTPPGRPRDGDTTPPRRPRDGETTPPRRPRDGETTPPRRPRDGGTTPPRWPRDGHPSPPRRPR
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR032059  Mucin-like  
Pfam View protein in Pfam  
PF16058  Mucin-like  
Amino Acid Sequences TGTTPPRWPRDGHPSPPRRPRDGDTAPPRRPRDGGTTPPGRPRDGDTTPPRRPRDGETTPPRRPRDGETTPPRRPRDGGTTPPRWPRDGHPSPPRRPRDGGNYASEMAPRRPPLASQTAPRRGNYASQTAPRRGNYASRDGPETATPRLPDGPETGETTPPRRPRDGETTPPRRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.76
3 0.83
4 0.83
5 0.78
6 0.75
7 0.7
8 0.7
9 0.67
10 0.68
11 0.69
12 0.72
13 0.73
14 0.76
15 0.75
16 0.68
17 0.62
18 0.56
19 0.54
20 0.52
21 0.52
22 0.51
23 0.55
24 0.54
25 0.6
26 0.59
27 0.5
28 0.44
29 0.42
30 0.41
31 0.37
32 0.44
33 0.45
34 0.52
35 0.59
36 0.67
37 0.65
38 0.6
39 0.59
40 0.56
41 0.56
42 0.53
43 0.55
44 0.57
45 0.63
46 0.68
47 0.74
48 0.7
49 0.64
50 0.59
51 0.55
52 0.54
53 0.52
54 0.54
55 0.56
56 0.62
57 0.67
58 0.74
59 0.7
60 0.63
61 0.57
62 0.51
63 0.5
64 0.48
65 0.5
66 0.49
67 0.51
68 0.54
69 0.6
70 0.57
71 0.5
72 0.45
73 0.43
74 0.47
75 0.5
76 0.56
77 0.59
78 0.68
79 0.76
80 0.83
81 0.83
82 0.76
83 0.7
84 0.63
85 0.62
86 0.59
87 0.53
88 0.46
89 0.41
90 0.37
91 0.35
92 0.33
93 0.26
94 0.2
95 0.2
96 0.18
97 0.17
98 0.16
99 0.17
100 0.2
101 0.26
102 0.27
103 0.3
104 0.39
105 0.47
106 0.49
107 0.48
108 0.46
109 0.39
110 0.42
111 0.38
112 0.35
113 0.3
114 0.35
115 0.4
116 0.42
117 0.46
118 0.41
119 0.41
120 0.37
121 0.4
122 0.37
123 0.4
124 0.39
125 0.37
126 0.39
127 0.37
128 0.37
129 0.35
130 0.34
131 0.29
132 0.28
133 0.26
134 0.25
135 0.27
136 0.26
137 0.24
138 0.24
139 0.24
140 0.23
141 0.27
142 0.26
143 0.29
144 0.31
145 0.33
146 0.38
147 0.43
148 0.46
149 0.44
150 0.45
151 0.45
152 0.52
153 0.54
154 0.56
155 0.59