Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZN30

Protein Details
Accession A0A4P9ZN30    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
6-32ATSRGATTEKRKPRAKKDPNAPKRNLSHydrophilic
NLS Segment(s)
PositionSequence
15-28KRKPRAKKDPNAPK
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPRLSATSRGATTEKRKPRAKKDPNAPKRNLSAYMFYSQAAREGVKQANPTASFGELGKRLGEQWKSMSDTEKVPYEQQAAADKIRYENEKASYRANSDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.56
3 0.64
4 0.7
5 0.78
6 0.83
7 0.85
8 0.85
9 0.87
10 0.89
11 0.91
12 0.92
13 0.85
14 0.79
15 0.73
16 0.67
17 0.6
18 0.51
19 0.44
20 0.37
21 0.35
22 0.3
23 0.25
24 0.22
25 0.17
26 0.16
27 0.13
28 0.11
29 0.1
30 0.13
31 0.14
32 0.15
33 0.16
34 0.15
35 0.18
36 0.18
37 0.18
38 0.15
39 0.14
40 0.12
41 0.11
42 0.13
43 0.1
44 0.11
45 0.1
46 0.09
47 0.1
48 0.15
49 0.16
50 0.15
51 0.17
52 0.19
53 0.22
54 0.23
55 0.24
56 0.21
57 0.22
58 0.23
59 0.24
60 0.22
61 0.21
62 0.22
63 0.22
64 0.21
65 0.22
66 0.24
67 0.23
68 0.23
69 0.25
70 0.23
71 0.23
72 0.26
73 0.27
74 0.26
75 0.28
76 0.34
77 0.37
78 0.39
79 0.41
80 0.41
81 0.41