Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1X9P1

Protein Details
Accession K1X9P1    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
96-122ATSNDFRREERERREQRRREQERKVLQBasic
NLS Segment(s)
PositionSequence
108-113RREQRR
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
KEGG mbe:MBM_00914  -  
Amino Acid Sequences MSHSNSRLSYTLKPAVIHSGSSLKDSRNPSTRLSTDFNRTTTTMGNGGYEERVEKRRVTDNERYYVTSTTSRDGKTYIHNQDRGIYDRGAPLLSQATSNDFRREERERREQRRREQERKVLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.35
4 0.31
5 0.26
6 0.25
7 0.23
8 0.26
9 0.27
10 0.21
11 0.26
12 0.31
13 0.35
14 0.38
15 0.4
16 0.4
17 0.45
18 0.46
19 0.44
20 0.44
21 0.42
22 0.42
23 0.42
24 0.4
25 0.35
26 0.34
27 0.3
28 0.26
29 0.24
30 0.18
31 0.15
32 0.14
33 0.12
34 0.12
35 0.11
36 0.09
37 0.09
38 0.1
39 0.13
40 0.14
41 0.15
42 0.17
43 0.25
44 0.29
45 0.35
46 0.41
47 0.42
48 0.45
49 0.45
50 0.44
51 0.37
52 0.34
53 0.29
54 0.23
55 0.2
56 0.19
57 0.21
58 0.2
59 0.19
60 0.19
61 0.19
62 0.21
63 0.29
64 0.35
65 0.38
66 0.4
67 0.4
68 0.43
69 0.44
70 0.42
71 0.37
72 0.28
73 0.23
74 0.22
75 0.22
76 0.18
77 0.15
78 0.12
79 0.12
80 0.12
81 0.11
82 0.1
83 0.15
84 0.2
85 0.22
86 0.25
87 0.25
88 0.26
89 0.32
90 0.4
91 0.43
92 0.47
93 0.56
94 0.63
95 0.72
96 0.81
97 0.84
98 0.87
99 0.89
100 0.91
101 0.9
102 0.9