Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9ZMX1

Protein Details
Accession A0A4P9ZMX1    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
42-64DYDEEPQTKRGRKKNRSNMFLDVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 13.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005100  NGN-domain  
IPR036735  NGN_dom_sf  
IPR039385  NGN_Euk  
IPR039659  SPT5  
IPR022581  Spt5_N  
Gene Ontology GO:0003746  F:translation elongation factor activity  
GO:0032784  P:regulation of DNA-templated transcription elongation  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF03439  Spt5-NGN  
PF11942  Spt5_N  
CDD cd09888  NGN_Euk  
Amino Acid Sequences MSDPYDSADLSGDDTYFPAQRSSLGKASRYDVDEEQIDYDDDYDEEPQTKRGRKKNRSNMFLDVEAEVDEEEEEDEEEEEDFSGFIQEEPEAHGEATRGTQHRAFDRRRDHDFDAEAEAARLSAKYGKRDTYRQGEAYADEGGYIPQRFLMPGVNDPSLWVLRCIPGKEKEIVMKLMRKYFDREYTDSPLEIISVFCRDSLKGYIYIEATKQSHVQFAVDGVQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.14
5 0.13
6 0.12
7 0.16
8 0.2
9 0.25
10 0.29
11 0.31
12 0.34
13 0.35
14 0.39
15 0.39
16 0.38
17 0.37
18 0.31
19 0.3
20 0.28
21 0.27
22 0.24
23 0.2
24 0.18
25 0.14
26 0.13
27 0.1
28 0.09
29 0.09
30 0.09
31 0.09
32 0.11
33 0.12
34 0.17
35 0.23
36 0.31
37 0.38
38 0.47
39 0.57
40 0.65
41 0.76
42 0.82
43 0.85
44 0.84
45 0.81
46 0.78
47 0.71
48 0.61
49 0.51
50 0.4
51 0.3
52 0.23
53 0.18
54 0.12
55 0.07
56 0.06
57 0.05
58 0.04
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.05
74 0.05
75 0.05
76 0.07
77 0.08
78 0.08
79 0.07
80 0.08
81 0.07
82 0.08
83 0.09
84 0.11
85 0.1
86 0.12
87 0.14
88 0.16
89 0.22
90 0.29
91 0.31
92 0.36
93 0.43
94 0.47
95 0.5
96 0.53
97 0.5
98 0.45
99 0.43
100 0.36
101 0.3
102 0.25
103 0.2
104 0.14
105 0.12
106 0.09
107 0.08
108 0.06
109 0.04
110 0.09
111 0.11
112 0.16
113 0.19
114 0.24
115 0.28
116 0.32
117 0.38
118 0.4
119 0.42
120 0.38
121 0.37
122 0.33
123 0.3
124 0.27
125 0.21
126 0.14
127 0.1
128 0.09
129 0.08
130 0.09
131 0.08
132 0.07
133 0.07
134 0.08
135 0.07
136 0.08
137 0.12
138 0.11
139 0.15
140 0.18
141 0.18
142 0.18
143 0.18
144 0.2
145 0.17
146 0.16
147 0.14
148 0.11
149 0.14
150 0.18
151 0.19
152 0.23
153 0.26
154 0.29
155 0.31
156 0.32
157 0.34
158 0.33
159 0.36
160 0.35
161 0.37
162 0.37
163 0.4
164 0.4
165 0.37
166 0.4
167 0.42
168 0.46
169 0.46
170 0.47
171 0.47
172 0.52
173 0.52
174 0.46
175 0.4
176 0.31
177 0.25
178 0.2
179 0.15
180 0.1
181 0.1
182 0.1
183 0.1
184 0.12
185 0.12
186 0.15
187 0.18
188 0.19
189 0.2
190 0.21
191 0.24
192 0.24
193 0.26
194 0.23
195 0.26
196 0.24
197 0.23
198 0.27
199 0.24
200 0.27
201 0.26
202 0.25
203 0.2
204 0.2