Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9ZLG3

Protein Details
Accession A0A4P9ZLG3    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-28STHTTGAHPKNQQHNRRPKPAGSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR003892  CUE  
IPR041803  DEF1_CUE  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0043130  F:ubiquitin binding  
Pfam View protein in Pfam  
PF02845  CUE  
PROSITE View protein in PROSITE  
PS51140  CUE  
CDD cd14368  CUE_DEF1_like  
Amino Acid Sequences MSDRKSTHTTGAHPKNQQHNRRPKPAGSQPSAKSQSKSFTDSEAAEIKELRKKYVDKLVTLHELFPAWTDEDLLCTLEEAYGDLDITIDRISEGFVSQWGHVGTRKVKRDGAAPAGVTKQRDDRAGKGGQTANKPGRTDKTRVRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.7
3 0.75
4 0.79
5 0.78
6 0.8
7 0.82
8 0.86
9 0.83
10 0.77
11 0.77
12 0.77
13 0.76
14 0.7
15 0.69
16 0.61
17 0.66
18 0.68
19 0.6
20 0.53
21 0.46
22 0.47
23 0.42
24 0.44
25 0.35
26 0.31
27 0.31
28 0.29
29 0.29
30 0.26
31 0.22
32 0.19
33 0.19
34 0.18
35 0.21
36 0.21
37 0.2
38 0.21
39 0.22
40 0.26
41 0.34
42 0.35
43 0.31
44 0.33
45 0.35
46 0.35
47 0.34
48 0.3
49 0.21
50 0.18
51 0.16
52 0.15
53 0.12
54 0.07
55 0.07
56 0.07
57 0.07
58 0.08
59 0.08
60 0.08
61 0.06
62 0.06
63 0.06
64 0.05
65 0.05
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.03
73 0.04
74 0.04
75 0.03
76 0.03
77 0.03
78 0.04
79 0.04
80 0.05
81 0.04
82 0.06
83 0.07
84 0.07
85 0.1
86 0.1
87 0.11
88 0.12
89 0.17
90 0.23
91 0.3
92 0.35
93 0.37
94 0.39
95 0.39
96 0.42
97 0.44
98 0.42
99 0.37
100 0.32
101 0.3
102 0.32
103 0.34
104 0.3
105 0.27
106 0.27
107 0.27
108 0.32
109 0.34
110 0.33
111 0.37
112 0.4
113 0.39
114 0.39
115 0.42
116 0.41
117 0.43
118 0.48
119 0.49
120 0.5
121 0.51
122 0.5
123 0.55
124 0.55
125 0.58