Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZKF3

Protein Details
Accession A0A4P9ZKF3   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
104-128TESLTRAHRNRAQRHKRYVIRIDFYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9, nucl 8, cyto 8, cysk 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR045867  DNA-dir_RpoC_beta_prime  
IPR007081  RNA_pol_Rpb1_5  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF04998  RNA_pol_Rpb1_5  
Amino Acid Sequences MQLQYLHSLVAPGEAVGLLAAQGVGEPSTQMTLNTFHFAGFGAKNVTLGIPRLREIVMTASTKPLTPSMTLPLLSHVTEKVATDFCKRMTRLRLAEVVDHVQVTESLTRAHRNRAQRHKRYVIRIDFYNKEACAEEYLITPEDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.04
12 0.04
13 0.04
14 0.04
15 0.06
16 0.06
17 0.07
18 0.08
19 0.1
20 0.12
21 0.14
22 0.14
23 0.12
24 0.12
25 0.13
26 0.14
27 0.12
28 0.11
29 0.11
30 0.11
31 0.11
32 0.11
33 0.11
34 0.09
35 0.1
36 0.12
37 0.11
38 0.12
39 0.13
40 0.13
41 0.12
42 0.12
43 0.13
44 0.13
45 0.13
46 0.13
47 0.14
48 0.14
49 0.15
50 0.14
51 0.13
52 0.11
53 0.11
54 0.12
55 0.13
56 0.14
57 0.14
58 0.13
59 0.14
60 0.14
61 0.13
62 0.12
63 0.09
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.1
70 0.13
71 0.15
72 0.17
73 0.22
74 0.23
75 0.28
76 0.32
77 0.38
78 0.37
79 0.39
80 0.4
81 0.36
82 0.36
83 0.33
84 0.29
85 0.22
86 0.19
87 0.16
88 0.11
89 0.1
90 0.1
91 0.09
92 0.07
93 0.09
94 0.11
95 0.18
96 0.2
97 0.28
98 0.33
99 0.42
100 0.52
101 0.61
102 0.7
103 0.73
104 0.81
105 0.83
106 0.85
107 0.85
108 0.84
109 0.81
110 0.75
111 0.72
112 0.69
113 0.62
114 0.57
115 0.53
116 0.43
117 0.36
118 0.32
119 0.28
120 0.24
121 0.22
122 0.2
123 0.17
124 0.2