Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZQM1

Protein Details
Accession A0A4P9ZQM1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-102GDKLVKGYRQWRDKRKAAKAAGQQHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, mito 4, cyto 2, plas 2, E.R. 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MKLLPSLALVLAAIGTVSMVHANPATTEDSTGHQPHLQKRWFRSGLTRASAGLAGAAAGTAVLPVVGTVIGGIGGLYGGDKLVKGYRQWRDKRKAAKAAGQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.02
4 0.03
5 0.04
6 0.04
7 0.05
8 0.06
9 0.06
10 0.06
11 0.08
12 0.1
13 0.1
14 0.11
15 0.11
16 0.13
17 0.17
18 0.18
19 0.18
20 0.18
21 0.22
22 0.27
23 0.35
24 0.38
25 0.39
26 0.42
27 0.5
28 0.5
29 0.46
30 0.47
31 0.45
32 0.45
33 0.42
34 0.38
35 0.29
36 0.27
37 0.26
38 0.19
39 0.12
40 0.06
41 0.04
42 0.03
43 0.03
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.01
50 0.01
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.03
66 0.03
67 0.03
68 0.05
69 0.09
70 0.11
71 0.15
72 0.24
73 0.34
74 0.44
75 0.54
76 0.63
77 0.7
78 0.76
79 0.83
80 0.84
81 0.85
82 0.81