Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9ZQ70

Protein Details
Accession A0A4P9ZQ70    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAKSKNHTNHNQNRKAHRNGIHydrophilic
NLS Segment(s)
PositionSequence
15-28KAHRNGIKRAASKP
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNRKAHRNGIKRAASKPKIAQFGVCQKFRRNMRYAAKKQQELNLEAKKAKVVAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.79
4 0.78
5 0.77
6 0.75
7 0.77
8 0.74
9 0.69
10 0.69
11 0.7
12 0.63
13 0.59
14 0.57
15 0.53
16 0.5
17 0.46
18 0.4
19 0.34
20 0.41
21 0.42
22 0.4
23 0.36
24 0.35
25 0.42
26 0.47
27 0.49
28 0.44
29 0.47
30 0.54
31 0.63
32 0.68
33 0.71
34 0.73
35 0.71
36 0.7
37 0.67
38 0.62
39 0.55
40 0.56
41 0.52
42 0.48
43 0.45
44 0.43
45 0.39