Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q0A040

Protein Details
Accession A0A4Q0A040   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
51-72RQSFRCFQKRHRCRMCRNAPSDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR022042  snRNA-activating_su3  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF12251  SNAPC3  
Amino Acid Sequences MSQTRFADLTLDLFTPYTFMHQGDCEHTLVITDVRKPIPLHDANNALVYPRQSFRCFQKRHRCRMCRNAPSDLVTADDFYSGQNPCFFCQNCYDLFHYGDKGELLYEYKVFPYVGGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.12
5 0.11
6 0.11
7 0.12
8 0.14
9 0.16
10 0.18
11 0.2
12 0.17
13 0.16
14 0.15
15 0.14
16 0.13
17 0.14
18 0.12
19 0.12
20 0.14
21 0.15
22 0.18
23 0.18
24 0.19
25 0.25
26 0.27
27 0.27
28 0.28
29 0.3
30 0.28
31 0.29
32 0.27
33 0.19
34 0.16
35 0.15
36 0.13
37 0.13
38 0.15
39 0.16
40 0.19
41 0.27
42 0.36
43 0.4
44 0.48
45 0.57
46 0.63
47 0.72
48 0.8
49 0.79
50 0.78
51 0.84
52 0.85
53 0.82
54 0.77
55 0.72
56 0.63
57 0.57
58 0.5
59 0.39
60 0.3
61 0.21
62 0.18
63 0.13
64 0.11
65 0.08
66 0.07
67 0.11
68 0.09
69 0.1
70 0.13
71 0.14
72 0.14
73 0.21
74 0.22
75 0.21
76 0.25
77 0.26
78 0.25
79 0.27
80 0.3
81 0.25
82 0.27
83 0.27
84 0.24
85 0.22
86 0.21
87 0.17
88 0.15
89 0.13
90 0.11
91 0.11
92 0.12
93 0.13
94 0.13
95 0.13
96 0.14
97 0.14