Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9ZS84

Protein Details
Accession A0A4P9ZS84    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
28-47KSPVGRAKKRIQYNRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
25-37DKPKSPVGRAKKR
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQCPKVEKQDKPKSPVGRAKKRIQYNRRFVNVTSIGGKRRMNPNTTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.48
4 0.49
5 0.52
6 0.59
7 0.63
8 0.68
9 0.69
10 0.72
11 0.75
12 0.74
13 0.75
14 0.74
15 0.68
16 0.65
17 0.66
18 0.65
19 0.65
20 0.66
21 0.69
22 0.7
23 0.75
24 0.77
25 0.79
26 0.79
27 0.79
28 0.8
29 0.77
30 0.71
31 0.62
32 0.61
33 0.53
34 0.45
35 0.41
36 0.35
37 0.34
38 0.37
39 0.38
40 0.35
41 0.42
42 0.46