Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZTG5

Protein Details
Accession A0A4P9ZTG5   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
61-83ALNDHKRRQCSNRPRQTFRYFARHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 12.5, cyto 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
IPR015318  Znf_GAGA-bd_fac  
Pfam View protein in Pfam  
PF09237  GAGA  
PF13912  zf-C2H2_6  
PROSITE View protein in PROSITE  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences KKDAVFYQQIERHKQENPLSCPVCQATFSQGSNRTRHMLIYTGDKYYHCPRCNLEFARLVALNDHKRRQCSNRPRQTFRYFARVSGISLQDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.5
3 0.54
4 0.54
5 0.56
6 0.54
7 0.51
8 0.5
9 0.43
10 0.37
11 0.28
12 0.24
13 0.19
14 0.21
15 0.22
16 0.24
17 0.3
18 0.33
19 0.35
20 0.36
21 0.33
22 0.29
23 0.29
24 0.25
25 0.21
26 0.18
27 0.22
28 0.21
29 0.2
30 0.2
31 0.19
32 0.22
33 0.27
34 0.34
35 0.28
36 0.29
37 0.31
38 0.36
39 0.42
40 0.41
41 0.37
42 0.33
43 0.33
44 0.34
45 0.32
46 0.26
47 0.22
48 0.26
49 0.3
50 0.31
51 0.38
52 0.37
53 0.41
54 0.47
55 0.53
56 0.58
57 0.61
58 0.67
59 0.71
60 0.78
61 0.82
62 0.85
63 0.83
64 0.81
65 0.74
66 0.73
67 0.63
68 0.55
69 0.53
70 0.45
71 0.41
72 0.39