Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1J482

Protein Details
Accession A0A4V1J482    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-35TTKRTTKGAGVEKKKRRGKKDPNAPKRSLSBasic
NLS Segment(s)
PositionSequence
9-32RTTKGAGVEKKKRRGKKDPNAPKR
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKAATTKRTTKGAGVEKKKRRGKKDPNAPKRSLSAYMFFAQSNRENIKRDNPDATFGQIGKMMGAQWKSMTDTDKIPYEDQARADKERYEEEKAAYAANGPDASSEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.61
3 0.66
4 0.7
5 0.79
6 0.84
7 0.83
8 0.83
9 0.84
10 0.85
11 0.86
12 0.88
13 0.89
14 0.91
15 0.9
16 0.84
17 0.76
18 0.68
19 0.61
20 0.54
21 0.45
22 0.37
23 0.32
24 0.3
25 0.28
26 0.24
27 0.21
28 0.19
29 0.19
30 0.2
31 0.2
32 0.22
33 0.23
34 0.25
35 0.33
36 0.35
37 0.35
38 0.35
39 0.32
40 0.32
41 0.3
42 0.3
43 0.22
44 0.18
45 0.16
46 0.13
47 0.12
48 0.09
49 0.08
50 0.07
51 0.09
52 0.09
53 0.09
54 0.09
55 0.09
56 0.11
57 0.13
58 0.14
59 0.13
60 0.15
61 0.17
62 0.21
63 0.22
64 0.21
65 0.23
66 0.24
67 0.25
68 0.26
69 0.3
70 0.3
71 0.31
72 0.32
73 0.31
74 0.3
75 0.35
76 0.37
77 0.38
78 0.36
79 0.35
80 0.37
81 0.35
82 0.33
83 0.25
84 0.23
85 0.17
86 0.18
87 0.16
88 0.12
89 0.12