Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V1J3Z0

Protein Details
Accession A0A4V1J3Z0    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-63KRKGRPTTQCQKCRENRRVRKTHNKCVCDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001083  Cu_fist_DNA-bd_dom  
IPR036395  Cu_fist_DNA-bd_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005507  F:copper ion binding  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00649  Copper-fist  
PROSITE View protein in PROSITE  
PS50073  COPPER_FIST_2  
Amino Acid Sequences MPIIDGKKFACAKCIKGHRASTCTHTSRDLIEIKRKGRPTTQCQKCRENRRVRKTHNKCVCDSPEEGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.54
4 0.61
5 0.58
6 0.58
7 0.56
8 0.52
9 0.51
10 0.47
11 0.42
12 0.36
13 0.31
14 0.29
15 0.31
16 0.3
17 0.25
18 0.31
19 0.35
20 0.35
21 0.4
22 0.41
23 0.39
24 0.41
25 0.46
26 0.47
27 0.53
28 0.61
29 0.64
30 0.67
31 0.74
32 0.76
33 0.79
34 0.8
35 0.81
36 0.81
37 0.84
38 0.89
39 0.89
40 0.91
41 0.9
42 0.91
43 0.9
44 0.84
45 0.77
46 0.76
47 0.71
48 0.64