Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZLA2

Protein Details
Accession A0A4P9ZLA2   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
36-63PQSLFRRGRKHSHKKGSHKKSGHKGHQSBasic
NLS Segment(s)
PositionSequence
41-59RRGRKHSHKKGSHKKSGHK
Subcellular Location(s) extr 7, cyto_nucl 6.833, cyto_mito 6.833, nucl 6.5, mito 6.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MVIGTMALASSTSQSSTSVLPQSASLVRHSDFHTQPQSLFRRGRKHSHKKGSHKKSGHKGHQSQSTVGDSGMDATGAPPTGTTAEQLVYGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.11
4 0.14
5 0.16
6 0.15
7 0.15
8 0.15
9 0.17
10 0.18
11 0.18
12 0.16
13 0.16
14 0.16
15 0.18
16 0.21
17 0.25
18 0.24
19 0.29
20 0.31
21 0.29
22 0.29
23 0.34
24 0.36
25 0.34
26 0.39
27 0.38
28 0.43
29 0.47
30 0.56
31 0.59
32 0.66
33 0.71
34 0.76
35 0.79
36 0.82
37 0.89
38 0.88
39 0.87
40 0.83
41 0.82
42 0.81
43 0.82
44 0.81
45 0.8
46 0.77
47 0.74
48 0.75
49 0.69
50 0.6
51 0.53
52 0.46
53 0.36
54 0.29
55 0.23
56 0.14
57 0.13
58 0.12
59 0.08
60 0.06
61 0.05
62 0.07
63 0.07
64 0.07
65 0.05
66 0.07
67 0.09
68 0.09
69 0.1
70 0.1
71 0.1