Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZWM1

Protein Details
Accession A0A4P9ZWM1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
28-57IRQELRRKRKYEKPTKKRIRLSVQRASKRFBasic
NLS Segment(s)
PositionSequence
33-49RRKRKYEKPTKKRIRLS
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
IPR038380  S21_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences SGRSIGIMGNSPLPAYSRLNTLLNNDGIRQELRRKRKYEKPTKKRIRLSVQRASKRFDALVQQKMALVDKMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.16
4 0.17
5 0.2
6 0.21
7 0.22
8 0.23
9 0.24
10 0.23
11 0.23
12 0.2
13 0.17
14 0.17
15 0.17
16 0.17
17 0.22
18 0.28
19 0.37
20 0.44
21 0.48
22 0.54
23 0.63
24 0.71
25 0.74
26 0.77
27 0.78
28 0.82
29 0.88
30 0.9
31 0.89
32 0.87
33 0.86
34 0.85
35 0.84
36 0.82
37 0.81
38 0.8
39 0.75
40 0.71
41 0.63
42 0.55
43 0.47
44 0.4
45 0.4
46 0.39
47 0.43
48 0.39
49 0.37
50 0.36
51 0.37
52 0.36