Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1X3A9

Protein Details
Accession K1X3A9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
11-30ELKAKFKSLLKSKGKKEKTAHydrophilic
NLS Segment(s)
PositionSequence
20-26LKSKGKK
Subcellular Location(s) mito 14.5, cyto 12, mito_nucl 8
Family & Domain DBs
KEGG mbe:MBM_06389  -  
Amino Acid Sequences MPGIPPNAFAELKAKFKSLLKSKGKKEKTAQPTETTNGATPTETTPAIVAAAATAPEVKPETVAAKVEEPAAGAAPVAPVVEATKTETPASAEPAKVEVTPTPAVEPEVKQDEPAPDPVPNPAAAVQIAALTGPAMAPAVPNPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.31
4 0.39
5 0.43
6 0.5
7 0.55
8 0.62
9 0.71
10 0.79
11 0.8
12 0.79
13 0.78
14 0.77
15 0.77
16 0.78
17 0.72
18 0.66
19 0.64
20 0.58
21 0.53
22 0.44
23 0.35
24 0.27
25 0.23
26 0.19
27 0.16
28 0.15
29 0.15
30 0.13
31 0.12
32 0.1
33 0.1
34 0.09
35 0.08
36 0.06
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.06
45 0.06
46 0.06
47 0.07
48 0.08
49 0.08
50 0.1
51 0.1
52 0.1
53 0.1
54 0.1
55 0.09
56 0.08
57 0.07
58 0.06
59 0.05
60 0.04
61 0.04
62 0.03
63 0.03
64 0.03
65 0.03
66 0.02
67 0.03
68 0.03
69 0.04
70 0.08
71 0.09
72 0.1
73 0.1
74 0.11
75 0.12
76 0.13
77 0.17
78 0.16
79 0.15
80 0.14
81 0.15
82 0.16
83 0.14
84 0.14
85 0.11
86 0.13
87 0.14
88 0.14
89 0.14
90 0.13
91 0.15
92 0.16
93 0.16
94 0.16
95 0.21
96 0.2
97 0.2
98 0.22
99 0.24
100 0.24
101 0.27
102 0.24
103 0.2
104 0.21
105 0.23
106 0.22
107 0.19
108 0.18
109 0.15
110 0.15
111 0.13
112 0.13
113 0.11
114 0.09
115 0.09
116 0.07
117 0.06
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.05