Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1W971

Protein Details
Accession K1W971    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
125-146EENSKLQKRVRAKKQEKANIEAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13.333, cyto 6, cyto_pero 3.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR003173  PC4_C  
IPR009044  ssDNA-bd_transcriptional_reg  
IPR045125  Sub1/Tcp4-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0003713  F:transcription coactivator activity  
GO:0060261  P:positive regulation of transcription initiation by RNA polymerase II  
KEGG mbe:MBM_07986  -  
Pfam View protein in Pfam  
PF02229  PC4  
Amino Acid Sequences MGKGKRGHDEVDEEEDIVENDDGAERKTKKSKNAASSSSNEDKFWELSNGKNPRRLNVSEFKGSKLISIREYYEKNGEYKPGSKGVSLNIEQYKALLKSIPELNAHLKTMGVDVSDSEIPENGPEENSKLQKRVRAKKQEKANIEATSDEDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.22
4 0.19
5 0.14
6 0.07
7 0.07
8 0.09
9 0.09
10 0.1
11 0.18
12 0.18
13 0.24
14 0.34
15 0.39
16 0.45
17 0.55
18 0.63
19 0.65
20 0.71
21 0.7
22 0.66
23 0.65
24 0.64
25 0.61
26 0.53
27 0.43
28 0.37
29 0.33
30 0.29
31 0.27
32 0.24
33 0.17
34 0.19
35 0.28
36 0.37
37 0.37
38 0.43
39 0.42
40 0.4
41 0.45
42 0.44
43 0.42
44 0.41
45 0.43
46 0.43
47 0.44
48 0.42
49 0.38
50 0.35
51 0.31
52 0.26
53 0.23
54 0.17
55 0.18
56 0.19
57 0.21
58 0.22
59 0.22
60 0.23
61 0.22
62 0.22
63 0.21
64 0.2
65 0.18
66 0.19
67 0.2
68 0.2
69 0.2
70 0.18
71 0.19
72 0.19
73 0.22
74 0.2
75 0.23
76 0.2
77 0.2
78 0.19
79 0.18
80 0.19
81 0.14
82 0.14
83 0.1
84 0.09
85 0.13
86 0.16
87 0.18
88 0.16
89 0.18
90 0.22
91 0.23
92 0.23
93 0.19
94 0.17
95 0.14
96 0.14
97 0.12
98 0.08
99 0.06
100 0.06
101 0.09
102 0.1
103 0.1
104 0.09
105 0.09
106 0.09
107 0.1
108 0.1
109 0.07
110 0.08
111 0.09
112 0.12
113 0.18
114 0.25
115 0.28
116 0.33
117 0.36
118 0.42
119 0.52
120 0.59
121 0.64
122 0.69
123 0.74
124 0.77
125 0.84
126 0.86
127 0.82
128 0.77
129 0.73
130 0.65
131 0.58
132 0.5
133 0.42