Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LG82

Protein Details
Accession E2LG82   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
79-98KPKKTKSKAAAVKKEKGMKKBasic
NLS Segment(s)
PositionSequence
55-98SKKRPIESEDNPKPAKRPAKDGAEKPKKTKSKAAAVKKEKGMKK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
KEGG mpr:MPER_05440  -  
Amino Acid Sequences MGVPVPPRPQPSFEVSDNFGNITSCDSPSRYHLPATPHALTPEEDELPADPFTKSKKRPIESEDNPKPAKRPAKDGAEKPKKTKSKAAAVKKEKGMKKEVDVEKDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.38
4 0.35
5 0.31
6 0.25
7 0.19
8 0.16
9 0.17
10 0.15
11 0.13
12 0.15
13 0.16
14 0.17
15 0.21
16 0.26
17 0.23
18 0.24
19 0.26
20 0.29
21 0.33
22 0.38
23 0.35
24 0.3
25 0.3
26 0.3
27 0.27
28 0.24
29 0.21
30 0.15
31 0.13
32 0.12
33 0.12
34 0.12
35 0.12
36 0.1
37 0.08
38 0.08
39 0.13
40 0.2
41 0.22
42 0.29
43 0.37
44 0.39
45 0.44
46 0.5
47 0.56
48 0.55
49 0.63
50 0.62
51 0.6
52 0.59
53 0.55
54 0.5
55 0.47
56 0.49
57 0.4
58 0.42
59 0.42
60 0.51
61 0.57
62 0.63
63 0.67
64 0.69
65 0.71
66 0.68
67 0.71
68 0.68
69 0.66
70 0.67
71 0.63
72 0.63
73 0.69
74 0.75
75 0.76
76 0.77
77 0.8
78 0.78
79 0.8
80 0.75
81 0.7
82 0.66
83 0.6
84 0.58
85 0.61
86 0.6
87 0.58