Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1XZR8

Protein Details
Accession K1XZR8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
44-67DDGNPQSGRRRRKRKFPIDEIRDDBasic
NLS Segment(s)
PositionSequence
51-58GRRRRKRK
Subcellular Location(s) extr 16, mito 2, cyto 2, plas 2, E.R. 2, golg 2, cyto_mito 2
Family & Domain DBs
KEGG mbe:MBM_03332  -  
Amino Acid Sequences MPPHMHPRSRLTSSLFATTLFASFFVVALPHALPCPAPRVAYADDGNPQSGRRRRKRKFPIDEIRDDGASLKDGSATEESSDDAEDAGAKRGKRECPVPKPGGLVGAILGFGSSSSDEKRTKPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.41
3 0.33
4 0.3
5 0.27
6 0.22
7 0.15
8 0.12
9 0.09
10 0.08
11 0.08
12 0.06
13 0.06
14 0.05
15 0.07
16 0.07
17 0.06
18 0.06
19 0.07
20 0.07
21 0.08
22 0.12
23 0.11
24 0.12
25 0.12
26 0.16
27 0.18
28 0.21
29 0.21
30 0.19
31 0.21
32 0.21
33 0.21
34 0.17
35 0.16
36 0.2
37 0.26
38 0.35
39 0.42
40 0.53
41 0.58
42 0.69
43 0.79
44 0.82
45 0.85
46 0.85
47 0.86
48 0.81
49 0.78
50 0.71
51 0.62
52 0.5
53 0.41
54 0.31
55 0.2
56 0.15
57 0.11
58 0.07
59 0.07
60 0.07
61 0.09
62 0.09
63 0.09
64 0.08
65 0.09
66 0.09
67 0.09
68 0.09
69 0.07
70 0.06
71 0.05
72 0.06
73 0.06
74 0.11
75 0.13
76 0.13
77 0.18
78 0.23
79 0.27
80 0.31
81 0.4
82 0.45
83 0.51
84 0.61
85 0.61
86 0.58
87 0.57
88 0.53
89 0.45
90 0.36
91 0.27
92 0.18
93 0.14
94 0.12
95 0.08
96 0.07
97 0.05
98 0.04
99 0.05
100 0.06
101 0.08
102 0.11
103 0.17
104 0.2