Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1XD57

Protein Details
Accession K1XD57   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
53-75SASASAKKKARPPKKNVGVQAEEHydrophilic
NLS Segment(s)
PositionSequence
58-67AKKKARPPKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002740  EVE_domain  
IPR015947  PUA-like_sf  
IPR047197  THYN1-like_EVE  
Gene Ontology GO:0005634  C:nucleus  
KEGG mbe:MBM_02990  -  
Pfam View protein in Pfam  
PF01878  EVE  
CDD cd21133  EVE  
Amino Acid Sequences MPPKRKAEHLGAGEQVEEQRPRRSSRRALTREARAVEQQPSQPASGSGSASASASASAKKKARPPKKNVGVQAEEDEGGNEEGGKEDDEKEDDEKEDGEKKDGEKNDDAEKEAPSTTAKTSKAARKPETADPSPPSGRQYWLLKAEPESRMEKGKDIKFSIDDLAAKTEPEPWDARNNLRAMKKGDLAFFYHSSCKVPAIVGTMEIVAEHSPDLTAHDPSAPYYDASSQPSDPKWSVVHVAFRQKLTTPITLKELRAWHAEPGGALANMQMLKLARMSVSKVSEAEWEFLVGEMRKRGDVVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.31
3 0.27
4 0.27
5 0.25
6 0.3
7 0.34
8 0.41
9 0.47
10 0.54
11 0.59
12 0.65
13 0.73
14 0.71
15 0.77
16 0.79
17 0.8
18 0.78
19 0.71
20 0.64
21 0.58
22 0.55
23 0.5
24 0.47
25 0.4
26 0.38
27 0.37
28 0.34
29 0.29
30 0.26
31 0.25
32 0.22
33 0.2
34 0.16
35 0.14
36 0.14
37 0.13
38 0.13
39 0.09
40 0.08
41 0.08
42 0.12
43 0.14
44 0.2
45 0.24
46 0.29
47 0.38
48 0.48
49 0.58
50 0.64
51 0.71
52 0.75
53 0.81
54 0.84
55 0.83
56 0.8
57 0.73
58 0.65
59 0.59
60 0.49
61 0.39
62 0.31
63 0.24
64 0.16
65 0.13
66 0.1
67 0.07
68 0.06
69 0.06
70 0.07
71 0.07
72 0.07
73 0.08
74 0.09
75 0.11
76 0.12
77 0.13
78 0.14
79 0.14
80 0.14
81 0.13
82 0.14
83 0.19
84 0.18
85 0.19
86 0.2
87 0.21
88 0.27
89 0.29
90 0.32
91 0.28
92 0.3
93 0.34
94 0.33
95 0.34
96 0.28
97 0.26
98 0.23
99 0.2
100 0.18
101 0.13
102 0.13
103 0.13
104 0.17
105 0.17
106 0.18
107 0.24
108 0.32
109 0.38
110 0.45
111 0.46
112 0.46
113 0.5
114 0.55
115 0.56
116 0.5
117 0.47
118 0.41
119 0.43
120 0.39
121 0.35
122 0.3
123 0.24
124 0.23
125 0.23
126 0.24
127 0.23
128 0.26
129 0.26
130 0.24
131 0.26
132 0.29
133 0.26
134 0.26
135 0.24
136 0.21
137 0.24
138 0.24
139 0.24
140 0.27
141 0.28
142 0.29
143 0.28
144 0.29
145 0.25
146 0.26
147 0.24
148 0.18
149 0.16
150 0.12
151 0.14
152 0.13
153 0.12
154 0.11
155 0.14
156 0.13
157 0.15
158 0.15
159 0.14
160 0.2
161 0.22
162 0.24
163 0.25
164 0.26
165 0.29
166 0.31
167 0.33
168 0.3
169 0.31
170 0.33
171 0.31
172 0.3
173 0.27
174 0.26
175 0.26
176 0.24
177 0.23
178 0.2
179 0.19
180 0.19
181 0.18
182 0.16
183 0.13
184 0.12
185 0.11
186 0.13
187 0.12
188 0.11
189 0.1
190 0.1
191 0.09
192 0.08
193 0.08
194 0.05
195 0.05
196 0.04
197 0.04
198 0.04
199 0.04
200 0.08
201 0.09
202 0.09
203 0.1
204 0.11
205 0.11
206 0.12
207 0.15
208 0.12
209 0.11
210 0.12
211 0.14
212 0.15
213 0.19
214 0.21
215 0.19
216 0.22
217 0.24
218 0.28
219 0.25
220 0.25
221 0.23
222 0.22
223 0.26
224 0.25
225 0.31
226 0.31
227 0.4
228 0.4
229 0.4
230 0.4
231 0.36
232 0.39
233 0.36
234 0.38
235 0.31
236 0.31
237 0.36
238 0.38
239 0.38
240 0.39
241 0.38
242 0.34
243 0.36
244 0.35
245 0.31
246 0.29
247 0.29
248 0.23
249 0.21
250 0.21
251 0.15
252 0.13
253 0.11
254 0.12
255 0.12
256 0.12
257 0.11
258 0.1
259 0.11
260 0.11
261 0.12
262 0.1
263 0.12
264 0.16
265 0.2
266 0.22
267 0.23
268 0.23
269 0.24
270 0.29
271 0.29
272 0.27
273 0.22
274 0.2
275 0.18
276 0.18
277 0.21
278 0.17
279 0.19
280 0.21
281 0.23
282 0.23