Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A433DAT9

Protein Details
Accession A0A433DAT9    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
23-47DADFPRMRPRRARRRARSHGSRAYRBasic
NLS Segment(s)
PositionSequence
28-55RMRPRRARRRARSHGSRAYRVLEAERKH
69-85RIGGGGAAGSGKRKGRG
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSIRHRSSGQTADYRPDARQISDADFPRMRPRRARRRARSHGSRAYRVLEAERKHQPAHAEGSAEAQGRIGGGGAAGSGKRKGRGKCGDGGGEGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.38
3 0.39
4 0.35
5 0.29
6 0.3
7 0.27
8 0.27
9 0.31
10 0.33
11 0.32
12 0.31
13 0.31
14 0.38
15 0.43
16 0.42
17 0.46
18 0.55
19 0.6
20 0.7
21 0.8
22 0.8
23 0.84
24 0.9
25 0.9
26 0.89
27 0.86
28 0.85
29 0.79
30 0.72
31 0.63
32 0.56
33 0.46
34 0.37
35 0.32
36 0.28
37 0.24
38 0.25
39 0.29
40 0.29
41 0.28
42 0.3
43 0.28
44 0.26
45 0.29
46 0.25
47 0.2
48 0.18
49 0.2
50 0.21
51 0.19
52 0.16
53 0.11
54 0.1
55 0.09
56 0.09
57 0.06
58 0.04
59 0.03
60 0.03
61 0.03
62 0.04
63 0.04
64 0.06
65 0.11
66 0.13
67 0.2
68 0.27
69 0.31
70 0.41
71 0.5
72 0.53
73 0.57
74 0.6
75 0.57