Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A433DF50

Protein Details
Accession A0A433DF50    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
119-146NSTGRRNPSRLRIRRRWRQRWGRGDLASHydrophilic
NLS Segment(s)
PositionSequence
122-159GRRNPSRLRIRRRWRQRWGRGDLASARRGGSRRPGEIE
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
Amino Acid Sequences MAKYHIAGSREMFPTRFSSETRGHRVAYGANHIFPTAISPSIITLKLHYHTHPPYTNPTYFLITPQTPPPRHSIQPAPDPRPSHATSTPSSSPVALGLPPPPLPRRRQKASSQHCPSPNSTGRRNPSRLRIRRRWRQRWGRGDLASARRGGSRRPGEIEKRVGLIGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.31
4 0.26
5 0.29
6 0.35
7 0.42
8 0.49
9 0.47
10 0.43
11 0.42
12 0.42
13 0.4
14 0.34
15 0.35
16 0.28
17 0.26
18 0.26
19 0.25
20 0.23
21 0.19
22 0.19
23 0.12
24 0.1
25 0.09
26 0.09
27 0.11
28 0.13
29 0.15
30 0.12
31 0.12
32 0.14
33 0.17
34 0.19
35 0.19
36 0.24
37 0.26
38 0.32
39 0.32
40 0.32
41 0.37
42 0.4
43 0.4
44 0.35
45 0.34
46 0.31
47 0.29
48 0.28
49 0.24
50 0.19
51 0.2
52 0.25
53 0.31
54 0.29
55 0.31
56 0.34
57 0.35
58 0.35
59 0.38
60 0.37
61 0.34
62 0.42
63 0.47
64 0.46
65 0.46
66 0.46
67 0.43
68 0.42
69 0.39
70 0.34
71 0.3
72 0.29
73 0.26
74 0.29
75 0.28
76 0.24
77 0.23
78 0.19
79 0.16
80 0.13
81 0.13
82 0.08
83 0.08
84 0.07
85 0.09
86 0.1
87 0.12
88 0.16
89 0.2
90 0.26
91 0.35
92 0.42
93 0.48
94 0.53
95 0.6
96 0.67
97 0.72
98 0.77
99 0.74
100 0.73
101 0.71
102 0.67
103 0.6
104 0.58
105 0.55
106 0.5
107 0.5
108 0.51
109 0.54
110 0.6
111 0.64
112 0.61
113 0.64
114 0.69
115 0.73
116 0.75
117 0.78
118 0.8
119 0.84
120 0.9
121 0.9
122 0.91
123 0.92
124 0.92
125 0.91
126 0.89
127 0.86
128 0.76
129 0.72
130 0.69
131 0.64
132 0.56
133 0.47
134 0.4
135 0.36
136 0.36
137 0.34
138 0.36
139 0.37
140 0.39
141 0.44
142 0.52
143 0.55
144 0.62
145 0.64
146 0.56
147 0.52