Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2M181

Protein Details
Accession E2M181    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
36-58SDNPAPPSKKKSKKPKQEAEDEEHydrophilic
NLS Segment(s)
PositionSequence
42-51PSKKKSKKPK
Subcellular Location(s) cyto 15, cyto_nucl 14, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR045864  aa-tRNA-synth_II/BPL/LPL  
KEGG mpr:MPER_13531  -  
Amino Acid Sequences RGLDYYTGIIYEAIVEASAPPGFKVNPDPSTSTAPSDNPAPPSKKKSKKPKQEAEDEEDEVDESQVGVGSIAAGGRYDNLVSMFAAAAASADSAKKAAKAGTPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.06
5 0.07
6 0.07
7 0.07
8 0.09
9 0.09
10 0.11
11 0.17
12 0.22
13 0.24
14 0.27
15 0.29
16 0.31
17 0.36
18 0.36
19 0.31
20 0.27
21 0.24
22 0.23
23 0.23
24 0.22
25 0.2
26 0.24
27 0.27
28 0.29
29 0.37
30 0.46
31 0.52
32 0.6
33 0.68
34 0.73
35 0.8
36 0.86
37 0.88
38 0.83
39 0.84
40 0.79
41 0.74
42 0.66
43 0.56
44 0.45
45 0.35
46 0.29
47 0.2
48 0.15
49 0.08
50 0.04
51 0.04
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.04
63 0.04
64 0.04
65 0.05
66 0.06
67 0.06
68 0.06
69 0.07
70 0.07
71 0.06
72 0.06
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.05
79 0.05
80 0.07
81 0.08
82 0.09
83 0.11
84 0.13