Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A433DIA2

Protein Details
Accession A0A433DIA2    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-27PHHPRRTFTNPHKKCVPKRSIFHPIPBasic
82-107SPSPHALKSHPRRRRHPSCPPTSDPAHydrophilic
NLS Segment(s)
PositionSequence
85-97PHALKSHPRRRRH
Subcellular Location(s) mito 18, nucl 6.5, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MPHHPRRTFTNPHKKCVPKRSIFHPIPFPPTLDVGLHLHWLRLRFLLELGPISEVICVGNHSHTVHAKVSNTPKPKLRDPNSPSPHALKSHPRRRRHPSCPPTSDPAGPPRVRSNLVRARGESAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.8
4 0.79
5 0.77
6 0.78
7 0.79
8 0.8
9 0.76
10 0.71
11 0.7
12 0.63
13 0.6
14 0.55
15 0.47
16 0.38
17 0.35
18 0.3
19 0.22
20 0.2
21 0.16
22 0.15
23 0.17
24 0.16
25 0.15
26 0.15
27 0.16
28 0.15
29 0.14
30 0.15
31 0.11
32 0.12
33 0.12
34 0.11
35 0.1
36 0.1
37 0.09
38 0.08
39 0.08
40 0.07
41 0.06
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.07
48 0.07
49 0.09
50 0.1
51 0.12
52 0.13
53 0.14
54 0.14
55 0.18
56 0.25
57 0.3
58 0.34
59 0.35
60 0.4
61 0.43
62 0.49
63 0.55
64 0.53
65 0.57
66 0.6
67 0.68
68 0.67
69 0.65
70 0.6
71 0.54
72 0.52
73 0.44
74 0.42
75 0.41
76 0.47
77 0.54
78 0.6
79 0.65
80 0.71
81 0.79
82 0.85
83 0.84
84 0.85
85 0.84
86 0.86
87 0.85
88 0.81
89 0.77
90 0.71
91 0.65
92 0.58
93 0.55
94 0.54
95 0.47
96 0.45
97 0.45
98 0.45
99 0.46
100 0.44
101 0.47
102 0.47
103 0.54
104 0.55
105 0.5