Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A433D6X6

Protein Details
Accession A0A433D6X6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-29SGDQDPPLRRCRKRDPRQLPSRRASSIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences MDSGDQDPPLRRCRKRDPRQLPSRRASSIRAISSVESLSSIRSTPFRPSKSQLLGPRHRHLSLWANRSRAVLTLSLSRQSLGPLYWQPPLMVSRAKIVFTPSLSRQPLRPFHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.78
3 0.84
4 0.86
5 0.87
6 0.92
7 0.94
8 0.91
9 0.88
10 0.83
11 0.76
12 0.68
13 0.6
14 0.58
15 0.54
16 0.46
17 0.4
18 0.35
19 0.31
20 0.29
21 0.26
22 0.17
23 0.12
24 0.1
25 0.09
26 0.09
27 0.09
28 0.08
29 0.1
30 0.12
31 0.19
32 0.26
33 0.29
34 0.32
35 0.36
36 0.42
37 0.43
38 0.48
39 0.48
40 0.49
41 0.55
42 0.57
43 0.57
44 0.53
45 0.5
46 0.44
47 0.4
48 0.4
49 0.38
50 0.4
51 0.4
52 0.38
53 0.39
54 0.39
55 0.36
56 0.28
57 0.22
58 0.15
59 0.13
60 0.16
61 0.17
62 0.18
63 0.17
64 0.17
65 0.15
66 0.15
67 0.15
68 0.1
69 0.13
70 0.14
71 0.17
72 0.19
73 0.19
74 0.18
75 0.19
76 0.2
77 0.19
78 0.19
79 0.17
80 0.22
81 0.23
82 0.24
83 0.23
84 0.25
85 0.25
86 0.25
87 0.3
88 0.28
89 0.35
90 0.39
91 0.4
92 0.42
93 0.48