Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A433DL88

Protein Details
Accession A0A433DL88    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-28VQKVKKFQMKYSKIRQHQPEWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto_nucl 9.833, cyto 9, nucl 7.5, cyto_pero 5.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR011604  PDDEXK-like_dom_sf  
IPR011335  Restrct_endonuc-II-like  
IPR019080  YqaJ_viral_recombinase  
Gene Ontology GO:0006302  P:double-strand break repair  
Pfam View protein in Pfam  
PF09588  YqaJ  
Amino Acid Sequences MATFKELVQKVKKFQMKYSKIRQHQPEWHALMGYTVGGSNLGSLFGVNPYKTVTQLIQNIIDIHHQGAHTLEYPPTCGWGNIFEQVARKYISWWFGCIVDCCNIYIQDEEMPNFRYSPDGIAVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.64
4 0.68
5 0.74
6 0.74
7 0.75
8 0.81
9 0.8
10 0.78
11 0.78
12 0.74
13 0.71
14 0.64
15 0.58
16 0.49
17 0.41
18 0.32
19 0.23
20 0.18
21 0.09
22 0.05
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.06
33 0.08
34 0.07
35 0.08
36 0.1
37 0.1
38 0.11
39 0.12
40 0.11
41 0.13
42 0.17
43 0.18
44 0.16
45 0.16
46 0.16
47 0.15
48 0.15
49 0.11
50 0.08
51 0.08
52 0.07
53 0.07
54 0.07
55 0.08
56 0.08
57 0.09
58 0.09
59 0.08
60 0.1
61 0.1
62 0.11
63 0.11
64 0.1
65 0.1
66 0.11
67 0.13
68 0.13
69 0.14
70 0.13
71 0.16
72 0.17
73 0.18
74 0.17
75 0.15
76 0.15
77 0.18
78 0.23
79 0.21
80 0.21
81 0.21
82 0.21
83 0.22
84 0.22
85 0.21
86 0.18
87 0.18
88 0.17
89 0.17
90 0.16
91 0.16
92 0.16
93 0.15
94 0.16
95 0.17
96 0.18
97 0.19
98 0.22
99 0.21
100 0.21
101 0.2
102 0.18
103 0.17
104 0.19