Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A433A2Z4

Protein Details
Accession A0A433A2Z4    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-30EPWPRNWHQCQCGRRRDRHLRTRLKLGLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MAEPWPRNWHQCQCGRRRDRHLRTRLKLGLATIPAHRLQRHICGGKVIDVNDILEVLSVMRRVVGSPKYLYLNSLPSSTLPDSAQPNNAFRLPCAPFLNTRGSPRSGEAAGLHQRPSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.8
4 0.82
5 0.84
6 0.86
7 0.87
8 0.88
9 0.88
10 0.84
11 0.85
12 0.78
13 0.7
14 0.61
15 0.52
16 0.46
17 0.38
18 0.34
19 0.25
20 0.24
21 0.23
22 0.24
23 0.23
24 0.22
25 0.22
26 0.26
27 0.32
28 0.32
29 0.3
30 0.29
31 0.3
32 0.3
33 0.3
34 0.24
35 0.18
36 0.15
37 0.15
38 0.12
39 0.11
40 0.07
41 0.05
42 0.04
43 0.03
44 0.04
45 0.04
46 0.03
47 0.04
48 0.04
49 0.04
50 0.08
51 0.1
52 0.12
53 0.13
54 0.15
55 0.17
56 0.17
57 0.18
58 0.16
59 0.18
60 0.17
61 0.17
62 0.15
63 0.13
64 0.18
65 0.17
66 0.17
67 0.14
68 0.16
69 0.19
70 0.2
71 0.26
72 0.24
73 0.25
74 0.26
75 0.29
76 0.25
77 0.22
78 0.28
79 0.24
80 0.27
81 0.28
82 0.27
83 0.28
84 0.31
85 0.38
86 0.34
87 0.37
88 0.37
89 0.37
90 0.37
91 0.36
92 0.37
93 0.29
94 0.28
95 0.24
96 0.28
97 0.33
98 0.33