Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A433A1H1

Protein Details
Accession A0A433A1H1    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
104-128LRHNPDYRKPVAKKPRRERVPVETTBasic
NLS Segment(s)
PositionSequence
112-120KPVAKKPRR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR047104  BLTP1_N  
IPR029636  Csf1  
Gene Ontology GO:0016020  C:membrane  
GO:0006113  P:fermentation  
Pfam View protein in Pfam  
PF20413  Kiaa1109_N  
Amino Acid Sequences MLAHSNERDALGALITYPLFAVNFDDPEQLSNLGPENSLFRRLMPVQLDITTGAITVGNPDLESIMVIEFVQANGDYNTAQSRSTLDEYRTSLALVLREPRCNLRHNPDYRKPVAKKPRRERVPVETT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.06
5 0.06
6 0.06
7 0.06
8 0.1
9 0.1
10 0.12
11 0.13
12 0.14
13 0.14
14 0.15
15 0.16
16 0.14
17 0.12
18 0.11
19 0.11
20 0.1
21 0.1
22 0.1
23 0.13
24 0.13
25 0.16
26 0.16
27 0.14
28 0.19
29 0.2
30 0.23
31 0.21
32 0.22
33 0.2
34 0.2
35 0.2
36 0.15
37 0.15
38 0.11
39 0.09
40 0.07
41 0.05
42 0.04
43 0.05
44 0.05
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.04
59 0.04
60 0.04
61 0.05
62 0.05
63 0.05
64 0.06
65 0.07
66 0.07
67 0.08
68 0.07
69 0.08
70 0.11
71 0.15
72 0.17
73 0.17
74 0.2
75 0.22
76 0.24
77 0.23
78 0.19
79 0.17
80 0.16
81 0.15
82 0.14
83 0.2
84 0.21
85 0.23
86 0.25
87 0.3
88 0.32
89 0.37
90 0.42
91 0.43
92 0.5
93 0.57
94 0.65
95 0.68
96 0.73
97 0.74
98 0.77
99 0.73
100 0.74
101 0.76
102 0.76
103 0.78
104 0.8
105 0.85
106 0.84
107 0.87
108 0.84