Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A433CW24

Protein Details
Accession A0A433CW24    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
83-106HTCGSTRLRRLPRRSGRRVRLVDSHydrophilic
NLS Segment(s)
PositionSequence
90-127LRRLPRRSGRRVRLVDSARGRRALRPGVLGRRHLVGRG
Subcellular Location(s) mito 16, extr 7, nucl 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MQPRQQQLGKKRASLQKQLVSLIPQLIVSTGRGIPPFLPLPLDHVPHLRLSPVHPSVFPQRRPARLRHVGTRPGDRNSDTFGHTCGSTRLRRLPRRSGRRVRLVDSARGRRALRPGVLGRRHLVGRGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.7
3 0.66
4 0.64
5 0.61
6 0.54
7 0.47
8 0.41
9 0.32
10 0.23
11 0.17
12 0.14
13 0.12
14 0.11
15 0.09
16 0.1
17 0.1
18 0.11
19 0.11
20 0.12
21 0.11
22 0.15
23 0.15
24 0.13
25 0.13
26 0.12
27 0.18
28 0.2
29 0.22
30 0.19
31 0.19
32 0.2
33 0.2
34 0.2
35 0.15
36 0.12
37 0.12
38 0.19
39 0.2
40 0.2
41 0.18
42 0.21
43 0.3
44 0.36
45 0.36
46 0.39
47 0.4
48 0.48
49 0.51
50 0.52
51 0.52
52 0.54
53 0.56
54 0.54
55 0.55
56 0.54
57 0.54
58 0.58
59 0.51
60 0.45
61 0.44
62 0.38
63 0.33
64 0.3
65 0.29
66 0.23
67 0.2
68 0.18
69 0.17
70 0.16
71 0.15
72 0.15
73 0.18
74 0.19
75 0.23
76 0.31
77 0.4
78 0.49
79 0.55
80 0.63
81 0.69
82 0.76
83 0.83
84 0.85
85 0.84
86 0.85
87 0.83
88 0.76
89 0.75
90 0.68
91 0.66
92 0.65
93 0.65
94 0.58
95 0.59
96 0.56
97 0.51
98 0.54
99 0.51
100 0.44
101 0.44
102 0.48
103 0.52
104 0.57
105 0.56
106 0.51
107 0.49
108 0.48