FuNGI

A0A433BA04

Protein Details

Accession

A0A433BA04

Localization Confidence

Medium

Confidence Score

10.8

NoLS Segment(s)

Position	Sequence	Protein Nature
59-78	SFLAPRPRRRAGRTVRPHAI	Hydrophilic

NLS Segment(s)

Position	Sequence
64-98	RPRRRAGRTVRPHAIPCWHRRGRGWPGEGGARLRR
187-190	PRRA

Subcellular Location(s)

plas 16, extr 4, nucl 2, mito 2, mito_nucl 2

Family & Domain DBs

InterPro	View protein in InterPro IPR011527 ABC1_TM_dom IPR036640 ABC1_TM_sf
Gene Ontology	GO:0016020 C:membrane GO:0140359 F:ABC-type transporter activity GO:0005524 F:ATP binding
Pfam	View protein in Pfam PF00664 ABC_membrane
PROSITE	View protein in PROSITE PS50929 ABC_TM1F

Amino Acid Sequences

MPIPDAVPRRPAADGPDRPAGPNLPSPILCATFPRLASQLLDPLLRQAAQPHVLSPCASFLAPRPRRRAGRTVRPHAIPCWHRRGRGWPGEGGARLRRQLGPVRGVRGAVHHGDEWGSDGERSDDETVDEVNGRIGQYRRLTPDLNNGDGDVENSPTTISPTPLDDATHALFTNGLGKDYGTLSKRPRRARRASSTTTTTTTATTVPVQTLTSSPHTNYIAKLRRLFPFMWPRNDRRLQLLIVLCLLLLVAERVVNVLLPISYKNVVDALAKEGGGGRVVWKEILIFVGLRMLQGGVGFIGTAQKGLWVPIGQFTTRELQVRMFEHLLNLSLRFHLNRKTGEILRVQGTPMFYSRAPTYPTSFNQPSTHAFLLLTFGPLHRPRRNKYRDASDNDLLQYPADADGRDGSVRVLHVGFRRVVRRDRVNDHGRVRWIYNAIDRMEDAVSQGD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.43
2	0.43
3	0.5
4	0.48
5	0.48
6	0.49
7	0.44
8	0.37
9	0.37
10	0.35
11	0.31
12	0.31
13	0.32
14	0.32
15	0.32
16	0.28
17	0.25
18	0.27
19	0.27
20	0.28
21	0.28
22	0.26
23	0.25
24	0.27
25	0.25
26	0.25
27	0.22
28	0.23
29	0.2
30	0.21
31	0.22
32	0.2
33	0.18
34	0.16
35	0.2
36	0.24
37	0.24
38	0.24
39	0.24
40	0.25
41	0.25
42	0.23
43	0.19
44	0.16
45	0.15
46	0.14
47	0.19
48	0.29
49	0.37
50	0.44
51	0.5
52	0.57
53	0.65
54	0.71
55	0.74
56	0.73
57	0.76
58	0.79
59	0.81
60	0.79
61	0.76
62	0.72
63	0.66
64	0.65
65	0.62
66	0.59
67	0.6
68	0.58
69	0.56
70	0.57
71	0.62
72	0.63
73	0.64
74	0.6
75	0.51
76	0.49
77	0.5
78	0.49
79	0.44
80	0.4
81	0.34
82	0.32
83	0.33
84	0.31
85	0.32
86	0.37
87	0.39
88	0.41
89	0.41
90	0.44
91	0.42
92	0.41
93	0.37
94	0.32
95	0.3
96	0.23
97	0.22
98	0.18
99	0.17
100	0.17
101	0.16
102	0.15
103	0.12
104	0.11
105	0.09
106	0.09
107	0.1
108	0.1
109	0.13
110	0.11
111	0.1
112	0.11
113	0.11
114	0.11
115	0.11
116	0.11
117	0.08
118	0.08
119	0.09
120	0.08
121	0.12
122	0.12
123	0.17
124	0.2
125	0.24
126	0.28
127	0.3
128	0.32
129	0.3
130	0.39
131	0.37
132	0.36
133	0.32
134	0.28
135	0.25
136	0.24
137	0.23
138	0.13
139	0.1
140	0.08
141	0.08
142	0.08
143	0.07
144	0.1
145	0.1
146	0.1
147	0.1
148	0.11
149	0.13
150	0.13
151	0.13
152	0.11
153	0.13
154	0.12
155	0.13
156	0.11
157	0.09
158	0.09
159	0.09
160	0.14
161	0.11
162	0.11
163	0.1
164	0.1
165	0.11
166	0.12
167	0.16
168	0.12
169	0.17
170	0.24
171	0.32
172	0.39
173	0.48
174	0.57
175	0.63
176	0.7
177	0.75
178	0.78
179	0.79
180	0.77
181	0.72
182	0.67
183	0.6
184	0.52
185	0.44
186	0.34
187	0.26
188	0.21
189	0.17
190	0.13
191	0.12
192	0.1
193	0.09
194	0.09
195	0.09
196	0.08
197	0.09
198	0.1
199	0.12
200	0.12
201	0.12
202	0.15
203	0.17
204	0.17
205	0.17
206	0.24
207	0.28
208	0.3
209	0.34
210	0.34
211	0.34
212	0.37
213	0.36
214	0.34
215	0.39
216	0.41
217	0.45
218	0.47
219	0.49
220	0.54
221	0.58
222	0.51
223	0.45
224	0.43
225	0.34
226	0.35
227	0.31
228	0.23
229	0.19
230	0.18
231	0.13
232	0.1
233	0.09
234	0.04
235	0.03
236	0.02
237	0.02
238	0.02
239	0.03
240	0.03
241	0.03
242	0.03
243	0.03
244	0.03
245	0.03
246	0.04
247	0.05
248	0.06
249	0.07
250	0.07
251	0.08
252	0.08
253	0.09
254	0.09
255	0.09
256	0.11
257	0.11
258	0.11
259	0.1
260	0.1
261	0.1
262	0.09
263	0.09
264	0.07
265	0.07
266	0.08
267	0.08
268	0.07
269	0.07
270	0.07
271	0.07
272	0.06
273	0.05
274	0.05
275	0.07
276	0.07
277	0.07
278	0.07
279	0.06
280	0.06
281	0.06
282	0.06
283	0.03
284	0.03
285	0.03
286	0.03
287	0.05
288	0.05
289	0.05
290	0.05
291	0.06
292	0.07
293	0.07
294	0.09
295	0.08
296	0.08
297	0.12
298	0.14
299	0.13
300	0.14
301	0.15
302	0.18
303	0.19
304	0.21
305	0.18
306	0.18
307	0.22
308	0.23
309	0.25
310	0.23
311	0.21
312	0.2
313	0.19
314	0.19
315	0.16
316	0.15
317	0.12
318	0.12
319	0.13
320	0.14
321	0.17
322	0.22
323	0.27
324	0.28
325	0.31
326	0.36
327	0.37
328	0.4
329	0.4
330	0.36
331	0.33
332	0.32
333	0.28
334	0.24
335	0.22
336	0.19
337	0.17
338	0.17
339	0.15
340	0.18
341	0.19
342	0.21
343	0.23
344	0.24
345	0.27
346	0.3
347	0.32
348	0.38
349	0.38
350	0.39
351	0.37
352	0.38
353	0.38
354	0.38
355	0.37
356	0.29
357	0.26
358	0.22
359	0.23
360	0.2
361	0.17
362	0.11
363	0.11
364	0.18
365	0.24
366	0.32
367	0.37
368	0.46
369	0.52
370	0.63
371	0.71
372	0.73
373	0.75
374	0.78
375	0.8
376	0.79
377	0.8
378	0.73
379	0.68
380	0.61
381	0.54
382	0.43
383	0.33
384	0.25
385	0.18
386	0.16
387	0.13
388	0.11
389	0.11
390	0.12
391	0.14
392	0.14
393	0.13
394	0.12
395	0.13
396	0.13
397	0.14
398	0.14
399	0.16
400	0.2
401	0.24
402	0.27
403	0.31
404	0.38
405	0.42
406	0.5
407	0.54
408	0.6
409	0.64
410	0.68
411	0.72
412	0.73
413	0.75
414	0.73
415	0.71
416	0.67
417	0.62
418	0.57
419	0.53
420	0.48
421	0.44
422	0.44
423	0.43
424	0.38
425	0.36
426	0.34
427	0.31
428	0.28
429	0.24

A0A433BA04

3D AlphaFold-predicted Structure Viewer