Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A433QSH3

Protein Details
Accession A0A433QSH3    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-26DVLTLRKYKRINKISKIKAKQTREEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 7, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR024145  His_deAcase_SAP30/SAP30L  
IPR038291  SAP30_C_sf  
IPR025718  SAP30_Sin3-bd  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF13867  SAP30_Sin3_bdg  
Amino Acid Sequences MDVLTLRKYKRINKISKIKAKQTREELVSAVTRHFSTIPVKEIEVVTTFLYSVQNKGTRFAPLIVFSNM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.86
4 0.85
5 0.84
6 0.84
7 0.8
8 0.78
9 0.74
10 0.69
11 0.61
12 0.55
13 0.45
14 0.37
15 0.33
16 0.26
17 0.19
18 0.15
19 0.12
20 0.12
21 0.12
22 0.11
23 0.12
24 0.13
25 0.16
26 0.15
27 0.16
28 0.16
29 0.16
30 0.15
31 0.13
32 0.13
33 0.1
34 0.1
35 0.09
36 0.09
37 0.12
38 0.12
39 0.12
40 0.16
41 0.21
42 0.21
43 0.24
44 0.25
45 0.25
46 0.27
47 0.28
48 0.26
49 0.24